KEGG   Homo sapiens (human): 2820Help
Entry
2820              CDS       T01001                                 

Gene name
GPD2, GDH2, GPDM, mGPDH
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    2820 (GPD2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     2820 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 FAD_binding_2 GIDA FAD_oxidored EF-hand_8 EF-hand_5 Pyr_redox_2 EF-hand_9 EF-hand_10 NAD_binding_8 HI0933_like FAD_binding_3 RNA_pol_Rpb4 Thi4 EF-hand_4 Pyr_redox_3 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 2820
NCBI-ProteinID: NP_000399
OMIM: 138430
HGNC: 4456
Ensembl: ENSG00000115159
Vega: OTTHUMG00000131951
Pharos: P43304(Tbio)
UniProt: P43304
LinkDB All DBs
Position
2q24.1
AA seq 727 aa AA seqDB search
MAFQKAVKGTILVGGGALATVLGLSQFAHYRRKQMNLAYVKAADCISEPVNREPPSREAQ
LLTLQNTSEFDILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPQTGKVRVSGARCKDVLTGQEFDVRAKCVINATGPFTDSVRKM
DDKDAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
VTHHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAVKTHNLKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDYKKQEQLETARKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESINVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcaaaaggcagtgaaagggacgattcttgttggaggaggtgctcttgcaact
gttttaggactttctcagtttgctcattacagaaggaaacaaatgaacctggcctatgtt
aaagcagcagactgcatttcagaaccagttaacagggagcctccttccagagaagctcag
ctactgactttgcaaaacacatctgaatttgatatccttgttattggaggaggagcaaca
ggaagtggctgtgcgctagatgctgtcaccagaggactaaaaacagcccttgtagaaaga
gatgatttctcatcagggaccagcagcagaagcactaaattgatccatggtggtgtgaga
tatctgcagaaggccatcatgaagttggatattgagcagtataggatggtaaaagaagcc
cttcatgagcgtgccaacctgctagaaattgctccccatttatcagctccattgcctata
atgcttccagtttacaagtggtggcagttaccttactactgggtaggaatcaagctgtat
gatttggttgcaggaagcaattgcctaaaaagcagttatgtcctcagcaaatcaagagcc
cttgaacatttcccaatgctccagaaggacaaactggtaggagcaattgtctactatgac
ggacaacataacgatgcacggatgaaccttgccattgctctgactgctgccaggtatggg
gctgccacagccaattacatggaggtagtgagcttgctcaagaagacagacccccagaca
gggaaagtgcgtgtgagcggcgcacggtgcaaggatgtcctcacagggcaggaatttgac
gtgagagccaaatgtgttatcaatgccacgggacctttcacggactctgtgcgcaaaatg
gatgataaagacgcagcagctatctgccagccaagtgctggtgtccatattgtgatgcct
ggttattacagcccagagagcatgggacttcttgacccagcgaccagtgatgggcgagtt
attttcttcttaccctggcaaaagatgacgatcgctggcactactgatactccaactgat
gttacacaccatccaattccttcagaagaagatatcaacttcattttgaatgaagtgcgt
aattacctgagttgtgatgttgaagtgagaagaggggatgtcctggcagcatggagtgga
atccgtcctcttgttacagaccccaaatctgcagatactcagtctatctcccgaaatcat
gttgttgatatcagtgagagtggccttattactatagcaggtggaaagtggacaacttat
cggtctatggcagaagataccataaatgctgctgtcaaaactcataatttaaaagcagga
ccaagtagaacagttgggcttttccttcaagggggtaaagattggagccccacactctac
attaggcttgtgcaggattatggacttgaaagcgaggtggcacagcatcttgccgccacc
tatggtgataaggcctttgaggtggccaaaatggcaagtgtgactggcaaaaggtggcct
attgttggagtacgtcttgtgtcagaatttccatatattgaagcagaggtgaaatatggg
attaaggagtatgcctgcactgctgtggatatgatttcacgtcgtactcgcctggccttt
ctaaatgtccaggcagcagaggaagccctacccaggattgttgaactgatgggcagggaa
ctgaattgggatgattataagaagcaggaacaacttgaaacagccaggaagtttctatat
tatgaaatgggctataaatctcgatcagaacagttaacagatcgctctgaaattagccta
ctgccttcagacattgacaggtataagaagagatttcataagtttgatgcagaccagaaa
ggctttattaccattgttgatgttcagcgtgtattagagagtatcaatgtccaaatggat
gaaaatacactccatgaaattctaaatgaagttgatttgaataaaaatggacaggttgaa
ctcaatgaatttttgcagctgatgagtgctattcaaaaaggaagggtatctggaagccgg
cttgctatactaatgaaaactgcagaagagaacctcgacagaagagttccaattccagtg
gaccgtagttgtggaggattgtga

DBGET integrated database retrieval system