KEGG   Homo sapiens (human): 2821Help
Entry
2821              CDS       T01001                                 

Gene name
GPI, AMF, GNPI, NLK, PGI, PHI, SA-36, SA36
Definition
(RefSeq) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00030  Pentose phosphate pathway
hsa00500  Starch and sucrose metabolism
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Network
nt06015  N-Glycan biosynthesis
nt06017  Glycogen metabolism
  Element
N00667  N-Glycan precursor biosynthesis, Glc-6P to Man-P-Dol
N00668  DPM1 deficiency in N-glycan precursor biosynthesis
N00669  DPM2 deficiency in N-glycan precursor biosynthesis
N00670  DPM3 deficiency in N-glycan precursor biosynthesis
N00671  PMM2 deficiency in N-glycan precursor biosynthesis
N00672  MPI deficiency in N-glycan precursor biosynthesis
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
N00735  ENO3 deficiency in glycolysis
N00737  PGAM2 deficiency in glycolysis
N00739  ALDOA deficiency in glycolysis
N00740  PFKM deficiency in glycolysis
Disease
H00664  Anemia due to disorders of glycolytic enzymes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    2821 (GPI)
   00030 Pentose phosphate pathway
    2821 (GPI)
   00500 Starch and sucrose metabolism
    2821 (GPI)
   00520 Amino sugar and nucleotide sugar metabolism
    2821 (GPI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2821 (GPI)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     2821 (GPI)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2821 (GPI)
  Exosomal proteins of other body fluids (saliva and urine)
   2821 (GPI)
  Exosomal proteins of colorectal cancer cells
   2821 (GPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-GeneID: 2821
NCBI-ProteinID: NP_000166
OMIM: 172400
HGNC: 4458
Ensembl: ENSG00000105220
Vega: OTTHUMG00000182087
Pharos: P06744(Tbio)
UniProt: P06744
LinkDB All DBs
Structure
PDB: 

Position
19q13.11
AA seq 558 aa AA seqDB search
MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLV
TEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMP
EVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPR
VWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVA
KHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESN
GKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL
HHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFT
KLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDA
STNGLINFIKQQREARVQ
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggccgctctcacccgggacccccagttccagaagctgcagcaatggtaccgcgagcac
cgctccgagctgaacctgcgccgcctcttcgatgccaacaaggaccgcttcaaccacttc
agcttgaccctcaacaccaaccatgggcatatcctggtggattactccaagaacctggtg
acggaggacgtgatgcggatgctggtggacttggccaagtccaggggcgtggaggccgcc
cgggagcggatgttcaatggtgagaagatcaactacaccgagggtcgagccgtgctgcac
gtggctctgcggaaccggtcaaacacacccatcctggtagacggcaaggatgtgatgcca
gaggtcaacaaggttctggacaagatgaagtctttctgccagcgtgtccggagcggtgac
tggaaggggtacacaggcaagaccatcacggacgtcatcaacattggcattggcggctcc
gacctgggacccctcatggtgactgaagcccttaagccatactcttcaggaggtccccgc
gtctggtatgtctccaacattgatggaactcacattgccaaaaccctggcccagctgaac
cccgagtcctccctgttcatcattgcctccaagacctttactacccaggagaccatcacg
aatgcagagacggcgaaggagtggtttctccaggcggccaaggatccttctgcagtggcg
aagcactttgttgccctgtctactaacacaaccaaagtgaaggagtttggaattgaccct
caaaacatgttcgagttctgggattgggtgggaggacgctactcgctgtggtcggccatc
ggactctccattgccctgcacgtgggttttgacaacttcgagcagctgctctcgggggct
cactggatggaccagcacttccgcacgacgcccctggagaagaacgcccccgtcttgctg
gccctgctgggtatctggtacatcaactgctttgggtgtgagacacacgccatgctgccc
tatgaccagtacctgcaccgctttgctgcgtacttccagcagggcgacatggagtccaat
gggaaatacatcaccaaatctggaacccgtgtggaccaccagacaggccccattgtgtgg
ggggagccagggaccaatggccagcatgctttttaccagctcatccaccaaggcaccaag
atgataccctgtgacttcctcatcccggtccagacccagcaccccatacggaagggtctg
catcacaagatcctcctggccaacttcttggcccagacagaggccctgatgaggggaaaa
tcgacggaggaggcccgaaaggagctccaggctgcgggcaagagtccagaggaccttgag
aggctgctgccacataaggtctttgaaggaaatcgcccaaccaactctattgtgttcacc
aagctcacaccattcatgcttggagccttggtcgccatgtatgagcacaagatcttcgtt
cagggcatcatctgggacatcaacagctttgaccagtggggagtggagctgggaaagcag
ctggctaagaaaatagagcctgagcttgatggcagtgctcaagtgacctctcacgacgct
tctaccaatgggctcatcaacttcatcaagcagcagcgcgaggccagagtccaataa

DBGET integrated database retrieval system