KEGG   Homo sapiens (human): 282618Help
Entry
282618            CDS       T01001                                 

Gene name
IFNL1, IL-29, IL29
Definition
(RefSeq) interferon lambda 1
  KO
K05447  interferon lambda 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    282618 (IFNL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282618 (IFNL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    282618 (IFNL1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   282618 (IFNL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL28A
Motif
Other DBs
NCBI-GeneID: 282618
NCBI-ProteinID: NP_742152
OMIM: 607403
HGNC: 18363
Ensembl: ENSG00000182393
Vega: OTTHUMG00000182807
Pharos: Q8IU54(Tbio)
UniProt: Q8IU54
LinkDB All DBs
Structure
PDB: 

Position
19q13.2
AA seq 200 aa AA seqDB search
MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEES
LKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHT
LHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRD
LKYVADGNLCLRTSTHPEST
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagcttggaccgtggtgctggtgactttggtgctaggcttggccgtggcaggc
cctgtccccacttccaagcccaccacaactgggaagggctgccacattggcaggttcaaa
tctctgtcaccacaggagctagcgagcttcaagaaggccagggacgccttggaagagtca
ctcaagctgaaaaactggagttgcagctctcctgtcttccccgggaattgggacctgagg
cttctccaggtgagggagcgccctgtggccttggaggctgagctggccctgacgctgaag
gtcctggaggccgctgctggcccagccctggaggacgtcctagaccagccccttcacacc
ctgcaccacatcctctcccagctccaggcctgtatccagcctcagcccacagcagggccc
aggccccggggccgcctccaccactggctgcaccggctccaggaggcccccaaaaaggag
tccgctggctgcctggaggcatctgtcaccttcaacctcttccgcctcctcacgcgagac
ctcaaatatgtggccgatgggaacctgtgtctgagaacgtcaacccaccctgagtccacc
tga

DBGET integrated database retrieval system