KEGG   Homo sapiens (human): 2834
Entry
2834              CDS       T01001                                 

Gene name
PRLHR, GPR10, GR3, PrRPR
Definition
(RefSeq) prolactin releasing hormone receptor
  KO
K04314  prolactin releasing hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2834 (PRLHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2834 (PRLHR)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Prolactin-releasing peptide (PrRP)
    2834 (PRLHR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 Herpes_US9 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 2834
NCBI-ProteinID: NP_004239
OMIM: 600895
HGNC: 4464
Ensembl: ENSG00000119973
Vega: OTTHUMG00000019136
Pharos: P49683(Tbio)
UniProt: P49683 A5JUU5
LinkDB
Position
10q26.11
AA seq 370 aa
MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK
GLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAY
AFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAV
LAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLV
ILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLL
RDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPH
GQNMTVSVVI
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggcctcatcgaccactcggggccccagggtttctgacttattttctgggctgccgccg
gcggtcacaactcccgccaaccagagcgcagaggcctcggcgggcaacgggtcggtggct
ggcgcggacgctccagccgtcacgcccttccagagcctgcagctggtgcatcagctgaag
gggctgatcgtgctgctctacagcgtcgtggtggtcgtggggctggtgggcaactgcctg
ctggtgctggtgatcgcgcgggtgcgccggctgcacaacgtgacgaacttcctcatcggc
aacctggccttgtccgacgtgctcatgtgcaccgcctgcgtgccgctcacgctggcctat
gccttcgagccacgcggctgggtgttcggcggcggcctgtgccacctggtcttcttcctg
cagccggtcaccgtctatgtgtcggtgttcacgctcaccaccatcgcagtggaccgctac
gtcgtgctggtgcacccgctgaggcggcgcatctcgctgcgcctcagcgcctacgctgtg
ctggccatctgggcgctgtccgcggtgctggcgctgcccgccgccgtgcacacctatcac
gtggagctcaagccgcacgacgtgcgcctctgcgaggagttctggggctcccaggagcgc
cagcgccagctctacgcctgggggctgctgctggtcacctacctgctccctctgctggtc
atcctcctgtcttacgtccgggtgtcagtgaagctccgcaaccgcgtggtgccgggctgc
gtgacccagagccaggccgactgggaccgcgctcggcgccggcgcaccttctgcttgctg
gtggtgatcgtggtggtgttcgccgtctgctggctgccgctgcacgtcttcaacctgctg
cgggacctcgacccccacgccatcgacccttacgcctttgggctggtgcagctgctctgc
cactggctcgccatgagttcggcctgctacaaccccttcatctacgcctggctgcacgac
agcttccgcgaggagctgcgcaaactgttggtcgcttggccccgcaagatagccccccat
ggccagaatatgaccgtcagcgtggtcatctga

DBGET integrated database retrieval system