KEGG   Homo sapiens (human): 283748Help
Entry
283748            CDS       T01001                                 

Gene name
PLA2G4D, cPLA2delta
Definition
(RefSeq) phospholipase A2 group IVD
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    283748 (PLA2G4D)
   00565 Ether lipid metabolism
    283748 (PLA2G4D)
   00590 Arachidonic acid metabolism
    283748 (PLA2G4D)
   00591 Linoleic acid metabolism
    283748 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    283748 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    283748 (PLA2G4D)
   04010 MAPK signaling pathway
    283748 (PLA2G4D)
   04370 VEGF signaling pathway
    283748 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    283748 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    283748 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    283748 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    283748 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    283748 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    283748 (PLA2G4D)
   04913 Ovarian steroidogenesis
    283748 (PLA2G4D)
   04921 Oxytocin signaling pathway
    283748 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    283748 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    283748 (PLA2G4D)
   04726 Serotonergic synapse
    283748 (PLA2G4D)
   04730 Long-term depression
    283748 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    283748 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    283748 (PLA2G4D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     283748 (PLA2G4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 283748
NCBI-ProteinID: NP_828848
OMIM: 612864
HGNC: 30038
Ensembl: ENSG00000159337
Vega: OTTHUMG00000172587
Pharos: Q86XP0(Tdark)
UniProt: Q86XP0
LinkDB All DBs
Structure
PDB: 

Position
15q15.1
AA seq 818 aa AA seqDB search
MESLSPGGPPGHPYQGEASTCWQLTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFK
TKTLTDTSHPVWNEAFRFLIQSQVKNVLELSIYDEDSVTEDDICFKVLYDISEVLPGKLL
RKTFSQSPQGEEELDVEFLMEETSDRPENLITNKVIVARELSCLDVHLDSTGSTAVVADQ
DKLELELVLKGSYEDTQTSFLGTASAFRFHYMAALETELSGRLRSSRSNGWNGDNSAGYL
TVPLRPLTIGKEVTMDVPAPNAPGVRLQLKAEGCPEELAVHLGFNLCAEEQAFLSRRKQV
VAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGI
SGSTWTMAHLYGDPEWSQRDLEGPIRYAREHLAKSKLEVFSPERLASYRRELELRAEQGH
PTTFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEW
VEFSPYEVGFLKYGAFVPPELFGSEFFMGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWY
DLTSSGESWKQHIKDKTRSLEKEPLTTSGTSSRLEASWLQPGTALAQAFKGFLTGRPLHQ
RSPNFLQGLQLHQDYCSHKDFSTWADYQLDSMPSQLTPKEPRLCLVDAAYFINTSSPSMF
RPGRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRVEPSPQDQHQPRECHLFSDPA
CPEAPILLHFPLVNASFKDHSAPGVQRSPAELQGGQVDLTGATCPYTLSNMTYKEEDFER
LLRLSDYNVQTSQGAILQALRTALKHRTLEARPPRAQT
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atggagagcctgtcacctgggggaccacctggccacccttaccagggggaggcctctacc
tgctggcagctcacagtgagggtcctggaggcgcggaacctgcgctgggctgacctgttg
agtgaggccgacccttacgtgatcctacagctgtcgaccgcacctggaatgaagtttaag
accaagacgctcaccgacaccagtcatcctgtgtggaatgaggccttccgtttccttatc
caaagtcaggtcaagaatgttctggagcttagcatctatgatgaggactcagtcacggag
gatgacatctgcttcaaggttctctatgacatctcagaagtcctccctggcaagctgctc
cggaaaaccttctcccagagtccccagggagaggaggagctggatgtggagttcctgatg
gaagaaacgtcagatcgcccagaaaacctcatcaccaacaaagtcattgtggcccgagag
ctgtcatgcctggatgtgcatctggacagcacagggagcaccgctgtggttgcagatcag
gacaagctggagctggagctggtgctgaaggggtcctatgaggacacacagacatccttc
ctgggcacagcctctgccttccgcttccactacatggcagccctagagacagagctgagc
gggcgcctgaggagctccagaagcaatggctggaatggggacaactcagctgggtacctc
actgtgcccctgaggcccttgaccattgggaaggaggtgactatggatgttcctgctcca
aatgccccaggagtgaggctgcagctcaaggcagagggctgccctgaggagctggccgtg
cacctgggcttcaatctctgtgcagaggagcaggccttcctgagcaggaggaagcaggtg
gtggccaaggccctgaagcaggccctgcagctggacagagacctgcaggaggatgaggta
cccgttgtgggcatcatggccacaggaggaggtgcccgggccatgacctcactctacggc
cacctattggccttgcagaagctgggcctcctagactgtgtgacctacttcagtggcatc
tctggctctacgtggacaatggcccacctgtacggggaccctgagtggtcgcagagggac
ctggagggacctatcagatacgcccgggagcacctggccaagagcaagctggaggtcttt
tccccagagcgcctggcgagctaccgccgggagctggagctgcgggctgagcagggccac
cccacgacctttgtggacctgtgggcgctagtgctggagtccatgctgcacggccaggtg
atggatcagaagctgtcaggacagagagccgccctggaacggggtcagaaccctctgccc
ctctacttgagcctcaatgtcaaagagaacaatctggagacactggacttcaaggagtgg
gttgagttctccccctatgaggtcggtttcctgaagtacggggccttcgtccctcctgag
ctcttcggctccgagttcttcatgggacggctgatgaggaggatcccggagccccggatc
tgctttctggaagccatctggagcaacattttctccctgaacctgctggatgcctggtat
gacctcaccagttctggggagtcctggaaacagcacatcaaggacaagaccaggagctta
gagaaggagcccctgaccacctcggggacctcctcgcggctggaggcctcgtggctgcag
ccaggcacggcgctggcccaggcatttaaaggcttcctgacaggcaggcccctccaccag
cgcagccccaacttcctccagggcctccagctgcaccaggactactgtagccacaaagac
ttctccacctgggcagactaccagcttgactccatgcccagccagctgacccccaaggag
ccccggctctgcctggtggacgccgcctacttcatcaacaccagctctccctccatgttc
cggccaggccgcaggctggacctcatcctctccttcgactactccctatctgcgcccttc
gaggcactgcagcagacggagctgtactgccgggcccgggggctgcccttcccccgggtg
gaacccagccctcaggaccagcaccagccaagggaatgccacctcttctcagaccccgcc
tgccccgaggccccgatcctgctgcacttcccgctggtcaatgcctccttcaaggaccac
tcagcccccggtgtccagcgcagccccgcagagctccagggtggccaagtggatctcacc
ggggccacctgcccctacaccctgtccaacatgacctacaaggaggaagacttcgagcgc
ctgctgcggctcagtgactacaacgtgcagaccagccagggtgccatcctgcaggccctg
aggaccgcgctgaagcaccggactctagaggcgaggcctccaagggcacagacctga

DBGET integrated database retrieval system