KEGG   Homo sapiens (human): 284Help
Entry
284               CDS       T01001                                 

Gene name
ANGPT1, AGP1, AGPT, ANG1
Definition
(RefSeq) angiopoietin 1
  KO
K05465  angiopoietin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa05323  Rheumatoid arthritis
Drug target
Trebananib: D10177
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    284 (ANGPT1)
   04015 Rap1 signaling pathway
    284 (ANGPT1)
   04010 MAPK signaling pathway
    284 (ANGPT1)
   04066 HIF-1 signaling pathway
    284 (ANGPT1)
   04151 PI3K-Akt signaling pathway
    284 (ANGPT1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    284 (ANGPT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    284 (ANGPT1)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   284 (ANGPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C
Motif
Other DBs
NCBI-GeneID: 284
NCBI-ProteinID: NP_001137
OMIM: 601667
HGNC: 484
Ensembl: ENSG00000154188
Vega: OTTHUMG00000164812
Pharos: Q15389(Tbio)
UniProt: Q15389
LinkDB All DBs
Structure
PDB: 

Position
8q23.1
AA seq 498 aa AA seqDB search
MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTD
QYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRA
TTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY
TIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNE
FIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL
HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFK
GPSYSLRSTTMMIRPLDF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacagttttcctttcctttgctttcctcgctgccattctgactcacatagggtgcagc
aatcagcgccgaagtccagaaaacagtgggagaagatataaccggattcaacatgggcaa
tgtgcctacactttcattcttccagaacacgatggcaactgtcgtgagagtacgacagac
cagtacaacacaaacgctctgcagagagatgctccacacgtggaaccggatttctcttcc
cagaaacttcaacatctggaacatgtgatggaaaattatactcagtggctgcaaaaactt
gagaattacattgtggaaaacatgaagtcggagatggcccagatacagcagaatgcagtt
cagaaccacacggctaccatgctggagataggaaccagcctcctctctcagactgcagag
cagaccagaaagctgacagatgttgagacccaggtactaaatcaaacttctcgacttgag
atacagctgctggagaattcattatccacctacaagctagagaagcaacttcttcaacag
acaaatgaaatcttgaagatccatgaaaaaaacagtttattagaacataaaatcttagaa
atggaaggaaaacacaaggaagagttggacaccttaaaggaagagaaagagaaccttcaa
ggcttggttactcgtcaaacatatataatccaggagctggaaaagcaattaaacagagct
accaccaacaacagtgtccttcagaagcagcaactggagctgatggacacagtccacaac
cttgtcaatctttgcactaaagaaggtgttttactaaagggaggaaaaagagaggaagag
aaaccatttagagactgtgcagatgtatatcaagctggttttaataaaagtggaatctac
actatttatattaataatatgccagaacccaaaaaggtgttttgcaatatggatgtcaat
gggggaggttggactgtaatacaacatcgtgaagatggaagtctagatttccaaagaggc
tggaaggaatataaaatgggttttggaaatccctccggtgaatattggctggggaatgag
tttatttttgccattaccagtcagaggcagtacatgctaagaattgagttaatggactgg
gaagggaaccgagcctattcacagtatgacagattccacataggaaatgaaaagcaaaac
tataggttgtatttaaaaggtcacactgggacagcaggaaaacagagcagcctgatctta
cacggtgctgatttcagcactaaagatgctgataatgacaactgtatgtgcaaatgtgcc
ctcatgttaacaggaggatggtggtttgatgcttgtggcccctccaatctaaatggaatg
ttctatactgcgggacaaaaccatggaaaactgaatgggataaagtggcactacttcaaa
gggcccagttactccttacgttccacaactatgatgattcgacctttagatttttga

KEGG   Homo sapiens (human): 285Help
Entry
285               CDS       T01001                                 

Gene name
ANGPT2, AGPT2, ANG2
Definition
(RefSeq) angiopoietin 2
  KO
K05466  angiopoietin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06124  Chemokine signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06224  CXCR signaling
  Element
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
Drug target
Faricimab: D11516
Nesvacumab: D10395
Trebananib: D10177
Vanucizumab: D11244
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    285 (ANGPT2)
   04015 Rap1 signaling pathway
    285 (ANGPT2)
   04010 MAPK signaling pathway
    285 (ANGPT2)
   04066 HIF-1 signaling pathway
    285 (ANGPT2)
   04151 PI3K-Akt signaling pathway
    285 (ANGPT2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    285 (ANGPT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    285 (ANGPT2)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   285 (ANGPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C SlyX
Motif
Other DBs
NCBI-GeneID: 285
NCBI-ProteinID: NP_001138
OMIM: 601922
HGNC: 485
Ensembl: ENSG00000091879
Vega: OTTHUMG00000090365
Pharos: O15123(Tbio)
UniProt: O15123
LinkDB All DBs
Structure
PDB: 

Position
8p23.1
AA seq 496 aa AA seqDB search
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPY
VSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQ
TAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSE
INKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVN
NSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTL
TFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFV
SQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPG
NDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGS
GYSLKATTMMIRPADF
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagattgttttctttactctgagctgtgatcttgtcttggccgcagcctataac
aactttcggaagagcatggacagcataggaaagaagcaatatcaggtccagcatgggtcc
tgcagctacactttcctcctgccagagatggacaactgccgctcttcctccagcccctac
gtgtccaatgctgtgcagagggacgcgccgctcgaatacgatgactcggtgcagaggctg
caagtgctggagaacatcatggaaaacaacactcagtggctaatgaagcttgagaattat
atccaggacaacatgaagaaagaaatggtagagatacagcagaatgcagtacagaaccag
acggctgtgatgatagaaatagggacaaacctgttgaaccaaacagcggagcaaacgcgg
aagttaactgatgtggaagcccaagtattaaatcagaccacgagacttgaacttcagctc
ttggaacactccctctcgacaaacaaattggaaaaacagattttggaccagaccagtgaa
ataaacaaattgcaagataagaacagtttcctagaaaagaaggtgctagctatggaagac
aagcacatcatccaactacagtcaataaaagaagagaaagatcagctacaggtgttagta
tccaagcaaaattccatcattgaagaactagaaaaaaaaatagtgactgccacggtgaat
aattcagttcttcagaagcagcaacatgatctcatggagacagttaataacttactgact
atgatgtccacatcaaactcagctaaggaccccactgttgctaaagaagaacaaatcagc
ttcagagactgtgctgaagtattcaaatcaggacacaccacgaatggcatctacacgtta
acattccctaattctacagaagagatcaaggcctactgtgacatggaagctggaggaggc
gggtggacaattattcagcgacgtgaggatggcagcgttgattttcagaggacttggaaa
gaatataaagtgggatttggtaacccttcaggagaatattggctgggaaatgagtttgtt
tcgcaactgactaatcagcaacgctatgtgcttaaaatacaccttaaagactgggaaggg
aatgaggcttactcattgtatgaacatttctatctctcaagtgaagaactcaattatagg
attcaccttaaaggacttacagggacagccggcaaaataagcagcatcagccaaccagga
aatgattttagcacaaaggatggagacaacgacaaatgtatttgcaaatgttcacaaatg
ctaacaggaggctggtggtttgatgcatgtggtccttccaacttgaacggaatgtactat
ccacagaggcagaacacaaataagttcaacggcattaaatggtactactggaaaggctca
ggctattcgctcaaggccacaaccatgatgatccgaccagcagatttctaa

KEGG   Homo sapiens (human): 51378Help
Entry
51378             CDS       T01001                                 

Gene name
ANGPT4, ANG3, ANG4
Definition
(RefSeq) angiopoietin 4
  KO
K05467  angiopoietin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    51378 (ANGPT4)
   04015 Rap1 signaling pathway
    51378 (ANGPT4)
   04010 MAPK signaling pathway
    51378 (ANGPT4)
   04066 HIF-1 signaling pathway
    51378 (ANGPT4)
   04151 PI3K-Akt signaling pathway
    51378 (ANGPT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    51378 (ANGPT4)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   51378 (ANGPT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C DcpS_C
Motif
Other DBs
NCBI-GeneID: 51378
NCBI-ProteinID: NP_057069
OMIM: 603705
HGNC: 487
Ensembl: ENSG00000101280
Vega: OTTHUMG00000031652
Pharos: Q9Y264(Tbio)
UniProt: Q9Y264
LinkDB All DBs
Position
20p13
AA seq 503 aa AA seqDB search
MLSQLAMLQGSLLLVVATMSVAQQTRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPE
VSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTILRSKLEQVQ
QQMAQNQTAPMLELGTSLLNQTTAQIRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQ
LLLQRQKLQQLQGQNSALEKRLQALETKQQEELASILSKKAKLLNTLSRQSAALTNIERG
LRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERANASAPAFIMAGEQVFQDCAEIQRSGAS
ASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEH
WLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQ
SSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIR
WHYFKGPSYSLRASRMMIRPLDI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccagctagccatgctgcagggcagcctcctccttgtggttgccaccatgtct
gtggctcaacagacaaggcaggaggcggataggggctgcgagacacttgtagtccagcac
ggccactgtagctacaccttcttgctgcccaagtctgagccctgccctccggggcctgag
gtctccagggactccaacaccctccagagagaatcactggccaacccactgcacctgggg
aagttgcccacccagcaggtgaaacagctggagcaggcactgcagaacaacacgcagtgg
ctgaagaagctagagagggccatcaagacgatcttgaggtcgaagctggagcaggtccag
cagcaaatggcccagaatcagacggcccccatgctagagctgggcaccagcctcctgaac
cagaccactgcccagatccgcaagctgaccgacatggaggctcagctcctgaaccagaca
tcaagaatggatgcccagatgccagagacctttctgtccaccaacaagctggagaaccag
ctgctgctacagaggcagaagctccagcagcttcagggccaaaacagcgcgctcgagaag
cggttgcaggccctggagaccaagcagcaggaggagctggccagcatcctcagcaagaag
gcgaagctgctgaacacgctgagccgccagagcgccgccctcaccaacatcgagcgcggc
ctgcgcggtgtcaggcacaactccagcctcctgcaggaccagcagcacagcctgcgccag
ctgctggtgttgttgcggcacctggtgcaagaaagggctaacgcctcggccccggccttc
ataatggcaggtgagcaggtgttccaggactgtgcagagatccagcgctctggggccagt
gccagtggtgtctacaccatccaggtgtccaatgcaacgaagcccaggaaggtgttctgt
gacctgcagagcagtggaggcaggtggaccctcatccagcgccgtgagaatggcaccgtg
aattttcagcggaactggaaggattacaaacagggcttcggagacccagctggggagcac
tggctgggcaatgaagtggtgcaccagctcaccagaagggcagcctactctctgcgtgtg
gagctgcaagactgggaaggccacgaggcctatgcccagtacgaacatttccacctgggc
agtgagaaccagctatacaggctttctgtggtcgggtacagcggctcagcagggcgccag
agcagcctggtcctgcagaacaccagctttagcacccttgactcagacaacgaccactgt
ctctgcaagtgtgcccaagtgatgtctggagggtggtggtttgacgcctgtggcctgtca
aacctcaacggcgtctactaccacgctcccgacaacaagtacaagatggacggcatccgc
tggcactacttcaagggccccagctactcactgcgtgcctctcgcatgatgatacggcct
ttggacatctaa

DBGET integrated database retrieval system