KEGG   Homo sapiens (human): 284654Help
Entry
284654            CDS       T01001                                 

Gene name
RSPO1, CRISTIN3, RSPO
Definition
(RefSeq) R-spondin 1
  KO
K19471  R-spondin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Disease
H02318  Palmoplantar hyperkeratosis with squamous cell carcinoma of skin and sex reversal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    284654 (RSPO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Furin-like_2 TSP_1 VSP
Motif
Other DBs
NCBI-GeneID: 284654
NCBI-ProteinID: NP_001033722
OMIM: 609595
HGNC: 21679
Ensembl: ENSG00000169218
Vega: OTTHUMG00000004321
Pharos: Q2MKA7(Tbio)
UniProt: Q2MKA7
LinkDB All DBs
Structure
PDB: 

Position
1p34.3
AA seq 263 aa AA seqDB search
MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKL
FILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYL
HKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVL
HAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSR
RRKGQQQQQQQGTVGPLTSAGPA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttgggctgtgtgtggtggccctggttctgagctggacgcacctcaccatcagc
agccgggggatcaaggggaaaaggcagaggcggatcagtgccgaggggagccaggcctgt
gccaaaggctgtgagctctgctctgaagtcaacggctgcctcaagtgctcacccaagctg
ttcatcctgctggagaggaacgacatccgccaggtgggcgtctgcttgccgtcctgccca
cctggatacttcgacgcccgcaaccccgacatgaacaagtgcatcaaatgcaagatcgag
cactgtgaggcctgcttcagccataacttctgcaccaagtgtaaggagggcttgtacctg
cacaagggccgctgctatccagcttgtcccgagggctcctcagctgccaatggcaccatg
gagtgcagtagtcctgcgcaatgtgaaatgagcgagtggtctccgtgggggccctgctcc
aagaagcagcagctctgtggtttccggaggggctccgaggagcggacacgcagggtgcta
catgcccctgtgggggaccatgctgcctgctctgacaccaaggagacccggaggtgcaca
gtgaggagagtgccgtgtcctgaggggcagaagaggaggaagggaggccagggccggcgg
gagaatgccaacaggaacctggccaggaaggagagcaaggaggcgggtgctggctctcga
agacgcaaggggcagcaacagcagcagcagcaagggacagtggggccactcacatctgca
gggcctgcctag

DBGET integrated database retrieval system