KEGG   Homo sapiens (human): 284654Help
Entry
284654            CDS       T01001                                 

Gene name
RSPO1, CRISTIN3, RSPO
Definition
(RefSeq) R-spondin 1
  KO
K19471  R-spondin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Disease
H02318  Palmoplantar hyperkeratosis with squamous cell carcinoma of skin and sex reversal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    284654 (RSPO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Furin-like_2 TSP_1 VSP
Motif
Other DBs
NCBI-GeneID: 284654
NCBI-ProteinID: NP_001033722
OMIM: 609595
HGNC: 21679
Ensembl: ENSG00000169218
Vega: OTTHUMG00000004321
Pharos: Q2MKA7(Tbio)
UniProt: Q2MKA7
LinkDB All DBs
Structure
PDB: 

Position
1p34.3
AA seq 263 aa AA seqDB search
MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKL
FILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYL
HKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVL
HAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSR
RRKGQQQQQQQGTVGPLTSAGPA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttgggctgtgtgtggtggccctggttctgagctggacgcacctcaccatcagc
agccgggggatcaaggggaaaaggcagaggcggatcagtgccgaggggagccaggcctgt
gccaaaggctgtgagctctgctctgaagtcaacggctgcctcaagtgctcacccaagctg
ttcatcctgctggagaggaacgacatccgccaggtgggcgtctgcttgccgtcctgccca
cctggatacttcgacgcccgcaaccccgacatgaacaagtgcatcaaatgcaagatcgag
cactgtgaggcctgcttcagccataacttctgcaccaagtgtaaggagggcttgtacctg
cacaagggccgctgctatccagcttgtcccgagggctcctcagctgccaatggcaccatg
gagtgcagtagtcctgcgcaatgtgaaatgagcgagtggtctccgtgggggccctgctcc
aagaagcagcagctctgtggtttccggaggggctccgaggagcggacacgcagggtgcta
catgcccctgtgggggaccatgctgcctgctctgacaccaaggagacccggaggtgcaca
gtgaggagagtgccgtgtcctgaggggcagaagaggaggaagggaggccagggccggcgg
gagaatgccaacaggaacctggccaggaaggagagcaaggaggcgggtgctggctctcga
agacgcaaggggcagcaacagcagcagcagcaagggacagtggggccactcacatctgca
gggcctgcctag

KEGG   Homo sapiens (human): 340419Help
Entry
340419            CDS       T01001                                 

Gene name
RSPO2, CRISTIN2, HHRRD, TETAMS2
Definition
(RefSeq) R-spondin 2
  KO
K23097  R-spondin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    340419 (RSPO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Furin-like_2 VSP
Motif
Other DBs
NCBI-GeneID: 340419
NCBI-ProteinID: NP_848660
OMIM: 610575
HGNC: 28583
Ensembl: ENSG00000147655
Vega: OTTHUMG00000164893
Pharos: Q6UXX9(Tbio)
UniProt: Q6UXX9 B3KVP3
LinkDB All DBs
Structure
PDB: 

Position
8q23.1
AA seq 243 aa AA seqDB search
MQFRLFSFALIILNCMDYSHCQGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLF
FFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLH
RGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKP
VKDTILCPTIAESRRCKMTMRHCPGGKRTPKAKEKRNKKKKRKLIERAQEQHSVFLATDR
ANQ
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttcgccttttctcctttgccctcatcattctgaactgcatggattacagccac
tgccaaggcaaccgatggagacgcagtaagcgagctagttatgtatcaaatcccatttgc
aagggttgtttgtcttgttcaaaggacaatgggtgtagccgatgtcaacagaagttgttc
ttcttccttcgaagagaagggatgcgccagtatggagagtgcctgcattcctgcccatcc
gggtactatggacaccgagccccagatatgaacagatgtgcaagatgcagaatagaaaac
tgtgattcttgctttagcaaagacttttgtaccaagtgcaaagtaggcttttatttgcat
agaggccgttgctttgatgaatgtccagatggttttgcaccattagaagaaaccatggaa
tgtgtggaaggatgtgaagttggtcattggagcgaatggggaacttgtagcagaaataat
cgcacatgtggatttaaatggggtctggaaaccagaacacggcaaattgttaaaaagcca
gtgaaagacacaatactgtgtccaaccattgctgaatccaggagatgcaagatgacaatg
aggcattgtccaggagggaagagaacaccaaaggcgaaggagaagaggaacaagaaaaag
aaaaggaagctgatagaaagggcccaggagcaacacagcgtcttcctagctacagacaga
gctaaccaataa

KEGG   Homo sapiens (human): 343637Help
Entry
343637            CDS       T01001                                 

Gene name
RSPO4, C20orf182, CRISTIN4
Definition
(RefSeq) R-spondin 4
  KO
K23099  R-spondin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Disease
H00683  Anonychia congenita
H01307  Nonsyndromic congenital nail disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    343637 (RSPO4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Furin-like_2
Motif
Other DBs
NCBI-GeneID: 343637
NCBI-ProteinID: NP_001025042
OMIM: 610573
HGNC: 16175
Ensembl: ENSG00000101282
Vega: OTTHUMG00000031651
Pharos: Q2I0M5(Tbio)
UniProt: Q2I0M5
LinkDB All DBs
Position
20p13
AA seq 234 aa AA seqDB search
MRAPLCLLLLVAHAVDMLALNRRKKQVGTGLGGNCTGCIICSEENGCSTCQQRLFLFIRR
EGIRQYGKCLHDCPPGYFGIRGQEVNRCKKCGATCESCFSQDFCIRCKRQFYLYKGKCLP
TCPPGTLAHQNTRECQGECELGPWGGWSPCTHNGKTCGSAWGLESRVREAGRAGHEEAAT
CQVLSESRKCPIQRPCPGERSPGQKKGRKDRRPRKDRKLDRRLDVRPRQPGLQP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgccactctgcctgctcctgctcgtcgcccacgccgtggacatgctcgccctg
aaccgaaggaagaagcaagtgggcactggcctggggggcaactgcacaggctgtatcatc
tgctcagaggagaacggctgttccacctgccagcagaggctcttcctgttcatccgccgg
gaaggcatccgccagtacggcaagtgcctgcacgactgtccccctgggtacttcggcatc
cgcggccaggaggtcaacaggtgcaaaaaatgtggggccacttgtgagagctgcttcagc
caggacttctgcatccggtgcaagaggcagttttacttgtacaaggggaagtgtctgccc
acctgcccgccgggcactttggcccaccagaacacacgggagtgccagggggagtgtgaa
ctgggtccctggggcggctggagcccctgcacacacaatggaaagacctgcggctcggct
tggggcctggagagccgggtacgagaggctggccgggctgggcatgaggaggcagccacc
tgccaggtgctttctgagtcaaggaaatgtcccatccagaggccctgcccaggagagagg
agccccggccagaagaagggcaggaaggaccggcgcccacgcaaggacaggaagctggac
cgcaggctggacgtgaggccgcgccagcccggcctgcagccctga

KEGG   Homo sapiens (human): 84870Help
Entry
84870             CDS       T01001                                 

Gene name
RSPO3, CRISTIN1, PWTSR, THSD2
Definition
(RefSeq) R-spondin 3
  KO
K23098  R-spondin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Drug target
Rosmantuzumab: D11369
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    84870 (RSPO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Furin-like_2
Motif
Other DBs
NCBI-GeneID: 84870
NCBI-ProteinID: NP_116173
OMIM: 610574
HGNC: 20866
Ensembl: ENSG00000146374
Vega: OTTHUMG00000015521
Pharos: Q9BXY4(Tbio)
UniProt: Q9BXY4
LinkDB All DBs
Position
6q22.33
AA seq 272 aa AA seqDB search
MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPR
LFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYL
HLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREII
QHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLES
SKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcacttgcgactgatttcttggctttttatcattttgaactttatggaatacatcggc
agccaaaacgcctcccggggaaggcgccagcgaagaatgcatcctaacgttagtcaaggc
tgccaaggaggctgtgcaacatgctcagattacaatggatgtttgtcatgtaagcccaga
ctattttttgctctggaaagaattggcatgaagcagattggagtatgtctctcttcatgt
ccaagtggatattatggaactcgatatccagatataaataagtgtacaaaatgcaaagct
gactgtgatacctgtttcaacaaaaatttctgcacaaaatgtaaaagtggattttactta
caccttggaaagtgccttgacaattgcccagaagggttggaagccaacaaccatactatg
gagtgtgtcagtattgtgcactgtgaggtcagtgaatggaatccttggagtccatgcacg
aagaagggaaaaacatgtggcttcaaaagagggactgaaacacgggtccgagaaataata
cagcatccttcagcaaagggtaacctgtgtcccccaacaaatgagacaagaaagtgtaca
gtgcaaaggaagaagtgtcagaagggagaacgaggaaaaaaaggaagggagaggaaaaga
aaaaaacctaataaaggagaaagtaaagaagcaatacctgacagcaaaagtctggaatcc
agcaaagaaatcccagagcaacgagaaaacaaacagcagcagaagaagcgaaaagtccaa
gataaacagaaatcggtatcagtcagcactgtacactag

DBGET integrated database retrieval system