KEGG   Homo sapiens (human): 285Help
Entry
285               CDS       T01001                                 

Gene name
ANGPT2, AGPT2, ANG2
Definition
(RefSeq) angiopoietin 2
  KO
K05466  angiopoietin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06124  Chemokine signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06224  CXCR signaling
  Element
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
Drug target
Faricimab: D11516
Nesvacumab: D10395
Trebananib: D10177
Vanucizumab: D11244
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    285 (ANGPT2)
   04015 Rap1 signaling pathway
    285 (ANGPT2)
   04010 MAPK signaling pathway
    285 (ANGPT2)
   04066 HIF-1 signaling pathway
    285 (ANGPT2)
   04151 PI3K-Akt signaling pathway
    285 (ANGPT2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    285 (ANGPT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    285 (ANGPT2)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   285 (ANGPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C SlyX
Motif
Other DBs
NCBI-GeneID: 285
NCBI-ProteinID: NP_001138
OMIM: 601922
HGNC: 485
Ensembl: ENSG00000091879
Vega: OTTHUMG00000090365
Pharos: O15123(Tbio)
UniProt: O15123
LinkDB All DBs
Structure
PDB: 

Position
8p23.1
AA seq 496 aa AA seqDB search
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPY
VSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQ
TAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSE
INKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVN
NSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTL
TFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFV
SQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPG
NDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGS
GYSLKATTMMIRPADF
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagattgttttctttactctgagctgtgatcttgtcttggccgcagcctataac
aactttcggaagagcatggacagcataggaaagaagcaatatcaggtccagcatgggtcc
tgcagctacactttcctcctgccagagatggacaactgccgctcttcctccagcccctac
gtgtccaatgctgtgcagagggacgcgccgctcgaatacgatgactcggtgcagaggctg
caagtgctggagaacatcatggaaaacaacactcagtggctaatgaagcttgagaattat
atccaggacaacatgaagaaagaaatggtagagatacagcagaatgcagtacagaaccag
acggctgtgatgatagaaatagggacaaacctgttgaaccaaacagcggagcaaacgcgg
aagttaactgatgtggaagcccaagtattaaatcagaccacgagacttgaacttcagctc
ttggaacactccctctcgacaaacaaattggaaaaacagattttggaccagaccagtgaa
ataaacaaattgcaagataagaacagtttcctagaaaagaaggtgctagctatggaagac
aagcacatcatccaactacagtcaataaaagaagagaaagatcagctacaggtgttagta
tccaagcaaaattccatcattgaagaactagaaaaaaaaatagtgactgccacggtgaat
aattcagttcttcagaagcagcaacatgatctcatggagacagttaataacttactgact
atgatgtccacatcaaactcagctaaggaccccactgttgctaaagaagaacaaatcagc
ttcagagactgtgctgaagtattcaaatcaggacacaccacgaatggcatctacacgtta
acattccctaattctacagaagagatcaaggcctactgtgacatggaagctggaggaggc
gggtggacaattattcagcgacgtgaggatggcagcgttgattttcagaggacttggaaa
gaatataaagtgggatttggtaacccttcaggagaatattggctgggaaatgagtttgtt
tcgcaactgactaatcagcaacgctatgtgcttaaaatacaccttaaagactgggaaggg
aatgaggcttactcattgtatgaacatttctatctctcaagtgaagaactcaattatagg
attcaccttaaaggacttacagggacagccggcaaaataagcagcatcagccaaccagga
aatgattttagcacaaaggatggagacaacgacaaatgtatttgcaaatgttcacaaatg
ctaacaggaggctggtggtttgatgcatgtggtccttccaacttgaacggaatgtactat
ccacagaggcagaacacaaataagttcaacggcattaaatggtactactggaaaggctca
ggctattcgctcaaggccacaaccatgatgatccgaccagcagatttctaa

DBGET integrated database retrieval system