KEGG   Homo sapiens (human): 286Help
Entry
286               CDS       T01001                                 

Gene name
ANK1, ANK, SPH1, SPH2
Definition
(RefSeq) ankyrin 1
  KO
K10380  ankyrin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05205  Proteoglycans in cancer
Disease
H00230  Hereditary spherocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    286 (ANK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    286 (ANK1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    286 (ANK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 UPA_2 ZU5 Death
Motif
Other DBs
NCBI-GeneID: 286
NCBI-ProteinID: NP_065209
OMIM: 612641
HGNC: 492
Ensembl: ENSG00000029534
Vega: OTTHUMG00000150281
Pharos: P16157(Tbio)
UniProt: P16157
LinkDB All DBs
Structure
PDB: 

Position
8p11.21
AA seq 1881 aa AA seqDB search
MPYSVGFREADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKM
VVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQ
ENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIA
ARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGI
TPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQA
KTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDK
GAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIV
KNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARI
GHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPL
HVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAW
NGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQAN
GNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFL
LQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYI
SVTDVLKVVTDETSFVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEE
KELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSD
NISPVASPVHTGFLVSFMVDARGGSMRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLS
TPPPLAEEEGLASRIIALGPTGAQFLSPVIVEIPHFASHGRGDRELVVLRSENGSVWKEH
RSRYGESYLDQILNGMDEELGSLEELEKKRVCRIITTDFPLYFVIMSRLCQDYDTIGPEG
GSLKSKLVPLVQATFPENAVTKRVKLALQAQPVPDELVTKLLGNQATFSPIVTVEPRRRK
FHRPIGLRIPLPPSWTDNPRDSGEGDTTSLRLLCSVIGGTDQAQWEDITGTTKLVYANEC
ANFTTNVSARFWLSDCPRTAEAVNFATLLYKELTAVPYMAKFVIFAKMNDPREGRLRCYC
MTDDKVDKTLEQHENFVEVARSRDIEVLEGMSLFAELSGNLVPVKKAAQQRSFHFQSFRE
NRLAMPVKVRDSSREPGGSLSFLRKAMKYEDTQHILCHLNITMPPCAKGSGAEDRRRTPT
PLALRYSILSESTPGSLSGTEQAEMKMAVISEHLGLSWAELARELQFSVEDINRIRVENP
NSLLEQSVALLNLWVIREGQNANMENLYTALQSIDRGEIVNMLEGSGRQSRNLKPDRRHT
DRDYSLSPSQMNGYSSLQDELLSPASLGCALSSPLRADQYWNEVAVLDAIPLAATEHDTM
LEMSDMQVWSAGLTPSLVTAEDSSLECSKAEDSDATGHEWKLEGALSEEPRGPELGSLEL
VEDDTVDSDATNGLIDLLEQEEGQRSEEKLPGSKRQDDATGAGQDSENEVSLVSGHQRGQ
ARITHSPTVSQVTERSQDRLQDWDADGSIVSYLQDAAQGSWQEEVTQGPHSFQGTSTMTE
GLEPGGSQEYEKVLVSVSEHTWTEQPEAESSQADRDRRQQGQEEQVQEAKNTFTQVVQGN
EFQNIPGEQVTEEQFTDEQGNIVTKKIIRKVVRQIDLSSADAAQEHEEVTVEGPLEDPSE
LEVDIDYFMKHSKDHTSTPNP
NT seq 5646 nt NT seq  +upstreamnt  +downstreamnt
atgccctattctgtgggcttccgcgaagccgatgctgctaccagctttctgagagcagca
agatcaggtaacttggacaaagctttggatcacctgcggaatggggtagatattaacacc
tgtaaccagaatgggttgaatggcttgcatctggcttctaaggaaggccatgtgaaaatg
gtggttgaacttctgcacaaagaaatcattctagaaacgacaaccaagaaggggaacacg
gccctgcacatcgctgctctagccgggcaggatgaggtggtccgggagcttgtcaactat
ggagccaacgtcaacgcccagtcacagaaaggttttacacccctgtacatggcagcacaa
gagaaccacttggaagtggttaagtttttactggaaaatggagctaaccagaatgtagcc
acagaagacggcttcacgcctctggcggtagccctgcagcagggccatgagaacgtcgtc
gcgcacctcatcaactacggcaccaaggggaaggtgcgcctcccggccctgcacatcgcg
gcccgcaacgacgacacgcgcacggctgcggtgctgctgcagaacgaccccaacccggac
gtgctttccaagacgggattcacgcccctgcacattgcggctcactacgagaacctcaac
gtggcccagttgctcctcaacagaggagccagcgtcaatttcacaccacagaacggcatc
acgccactgcacatcgcctcccgcaggggcaacgtgatcatggtgcggctgctgctggat
cggggagcccagatagaaaccaagaccaaggacgaattgacacctctccactgtgcagct
cgaaatgggcacgtgcgaatctcagagatcctgctggaccacggggcaccaatccaagcc
aaaaccaagaacggcctgtccccaattcacatggcggctcagggagaccacctcgactgt
gtccggctcctgttgcaatacgacgcagagatagacgacatcaccctggaccacctgacc
ccactccacgtggctgcccactgtggacaccacagggtggctaaggtccttctggataaa
ggggccaaacccaactccagagccctgaatggctttacccccttacacatcgcctgcaaa
aagaaccacgtccgtgtcatggagctgctgctgaagacgggagcctcgatcgacgcggtc
accgagtctggcctgacacctctccacgtggcctccttcatggggcaccttcccatcgtg
aagaacctcctgcagcggggggcgtcgcccaacgtctccaacgtgaaagtggagaccccg
ctacacatggcagccagagccgggcacacggaagtggccaaatatttactccagaacaaa
gccaaagtcaatgccaaggccaaggatgaccagaccccacttcactgtgcagctcgcatc
ggccacacaaacatggtgaagctcctgctggaaaataacgccaaccccaacctggccacc
accgccgggcacacccccctgcacattgcagcccgtgagggccatgtggaaacagtcctg
gcccttctggaaaaggaagcatcccaggcctgcatgaccaagaaaggatttacccctctg
cacgtggcggccaagtacgggaaggtgcgggtggcagagctgctgctggagcgggacgca
cacccgaatgctgccggaaaaaatggcctgacccccctgcacgtggccgtccatcacaac
aacctggacatcgtcaagctgctgcttccccggggcggctccccgcacagccctgcctgg
aatggctacacccctttgcacatcgctgccaagcagaaccaggtggaggtggcccgtagt
ctgctgcagtatgggggctcagcaaacgccgagtcggtgcaaggtgtgacgccccttcac
ctggccgcccaggagggccacgcagagatggtggctctgctgctctcgaaacaagccaat
ggcaacctggggaacaagagcggactcactcccctccatctggtagcacaagaaggccac
gttccagtggcagatgtgctgatcaaacacggcgtcatggtggacgccaccacccggatg
ggctacactcccctccatgtggccagtcactatggaaacatcaagctggtgaagtttctg
ctgcagcaccaggcagatgtcaatgccaagaccaagctaggatacagccccctgcaccag
gcagcccagcagggacacacagacatcgtgactctgcttctgaaaaacggtgcttcccca
aacgaggtcagctcggatggaaccacacctctggccatagccaagcgcttgggctacatt
tctgtcaccgacgtgctcaaggtcgtcacggatgaaaccagtttcgtgttagtcagtgat
aagcatcgaatgagtttccctgagacagttgatgagatcctggatgtctcggaagatgaa
ggggaagaactcatcagcttcaaggctgagaggcgggattccagggatgttgatgaagag
aaggagctgctggattttgtgccgaagctagaccaagtggtggaatctccagccatcccc
aggattccctgtgccatgcctgagacagtggtgatcaggtcagaagagcaggagcaggca
tctaaagagtatgatgaggactccctcatccccagcagcccggccaccgagacctcagac
aacatcagcccggtggccagcccggtgcatacagggtttctggtgagcttcatggttgac
gcccggggtggttccatgagaggaagtcgccacaacggcctgcgagtggtgatcccgcca
cggacgtgcgcagcgcccacccgcatcacctgccgcctggtcaagccccagaagctcagc
acgccgcccccactggccgaggaggagggcctggccagcaggatcatagcactggggccc
acgggggcacagttcctgagccctgtaatcgtggagatcccgcactttgcctcccatggc
cgtggagaccgcgagctcgtggttctgaggagcgaaaacggctccgtgtggaaggagcac
aggagccgctatggagagagctacctggatcagatcctcaacgggatggacgaagagctg
gggagcctggaggagctagagaagaagagggtgtgccgaatcatcaccaccgacttcccg
ctgtacttcgtgatcatgtcacggctctgccaggactacgacaccatcggtcccgaaggg
ggctccctgaagagcaagctggtgcccctggtacaggcaacgttcccggagaatgccgtc
accaagagagtgaagctggctctgcaggcccagcctgtcccggatgagcttgtcactaag
ctcctgggcaaccaggccacattcagccccattgtcaccgtggagccccggcgccggaag
ttccaccgccccattgggcttcggatcccactacctccttcctggaccgacaacccgagg
gacagcggggagggagacaccaccagcctgcgcctgctttgcagcgtcattggaggaaca
gaccaagcccagtgggaagacataacaggaaccaccaaacttgtatatgccaacgagtgc
gccaacttcaccaccaatgtctctgccaggttttggctgtcggactgtcctcggactgct
gaggctgtgaactttgccaccctgctgtacaaagagctcactgcagtgccctacatggcc
aaattcgtcatctttgccaagatgaatgacccccgagaggggcgcctgcgctgctactgc
atgacagatgataaagtggacaagaccctggagcagcatgagaacttcgtggaggtggcc
cggagcagggacatagaggtgttggaaggaatgtccctgtttgcagaactctctgggaac
ctggtgcctgtgaagaaagctgcccagcagcggagcttccacttccagtcatttcgggag
aaccgtctggccatgcctgtaaaggtgagggacagcagtcgagagccgggagggtccctg
tcgtttctgcgcaaggcgatgaagtacgaggacacccagcacattctctgccacctgaac
atcaccatgcccccctgcgccaagggaagtggagccgaagataggagaaggaccccgacg
cccctggccctgcgatacagcattctcagtgagtccacaccaggttctctcagtgggaca
gagcaggcagagatgaagatggctgttatctcagagcacctcggtctcagctgggcagag
ttggcccgggagctgcagttcagtgtggaagacatcaacaggatccgagtggaaaatccc
aactccctgttggagcagagtgtggccttgctgaacctctgggtcatccgtgaaggccaa
aacgcaaacatggagaatctgtacacagccctgcagagcattgaccgtggcgagatcgtg
aacatgctggagggttccggccgacagagccgcaacttgaagccagacaggcggcacacc
gaccgcgactactcgctgtcaccctcccagatgaatggttactcctcactgcaggacgag
ctgctgtcccctgcctccctgggctgtgcactttcctctccgctacgtgcagaccagtac
tggaatgaggtggccgtcctagacgccatccccttggcggccacggagcatgacaccatg
ctggagatgtctgacatgcaggtgtggtctgcgggcctcacgccttctctggtcactgct
gaggactcctctctggagtgtagcaaggctgaggactctgatgccacaggtcacgagtgg
aagttggagggggcactctcagaggaaccgcggggccccgagttgggctctctggaactt
gtggaggacgacacagtggattcagatgccacaaatggccttatcgatttgcttgaacag
gaggaaggtcagaggtcagaagagaagctgccaggttctaagaggcaggatgacgcgaca
ggtgcagggcaggactcagagaatgaagtgtctcttgtttcaggccatcagagggggcaa
gcccgaatcacacattcccccaccgtgagtcaggtgacggagaggagtcaggacagactg
caggactgggatgcagacggctcgattgtctcatacctgcaagatgctgcacaaggttcc
tggcaagaggaggtcacgcaaggtccacactcattccagggaacaagtaccatgactgaa
gggctagagcccggtggatctcaggagtacgagaaggtcctggtgtctgtaagtgagcac
acgtggacagaacagcccgaggctgagagctcccaggccgacagggaccggaggcagcaa
ggccaagaagagcaggtgcaggaggccaagaacaccttcacccaagtggtgcaggggaat
gagtttcagaatattccaggggagcaggtgacagaggagcaattcacggatgagcagggc
aacattgtcaccaagaagatcattcgcaaggtggttcgacagatagacttgtccagcgcc
gatgccgcccaggagcacgaggaggtgactgtagaggggcccctggaggatcccagtgag
ctggaggtcgatattgattactttatgaaacactccaaggatcacacctcgacacccaac
ccctga

KEGG   Homo sapiens (human): 287Help
Entry
287               CDS       T01001                                 

Gene name
ANK2, ANK-2, LQT4, brank-2
Definition
(RefSeq) ankyrin 2
  KO
K10380  ankyrin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05205  Proteoglycans in cancer
Disease
H00720  Long QT syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    287 (ANK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    287 (ANK2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    287 (ANK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 UPA_2 ZU5 Death
Motif
Other DBs
NCBI-GeneID: 287
NCBI-ProteinID: NP_001139
OMIM: 106410
HGNC: 493
Ensembl: ENSG00000145362
Vega: OTTHUMG00000132912
Pharos: Q01484(Tbio)
UniProt: Q01484
LinkDB All DBs
Structure
PDB: 

Position
4q25-q26
AA seq 3957 aa AA seqDB search
MMNEDAAQKSDSGEKFNGSSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTC
NQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEG
ANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVA
ILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIA
AHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGL
TPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDD
VTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY
GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVV
RCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISARE
GQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPL
HVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTK
QGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGAD
QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVL
LQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMT
EVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLR
SFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALS
SSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPM
VEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVE
IPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRIC
RIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQP
MHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRL
LCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYRE
IICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKP
IYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGL
VHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLAS
PDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLE
KVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVR
IDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGK
DIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGED
PGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKK
TTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPS
AKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSG
RTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSK
TERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQR
EAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVP
EEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETE
KAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLME
GTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHP
TTKDITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETP
TGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQ
GVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPL
KESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDD
SLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKK
RFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHT
GSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMD
SNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYD
KLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEK
DTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTD
ETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSE
ESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQE
STLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVK
EEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMT
KRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEAD
LLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVK
QISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTES
KSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQ
LSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRER
AEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEE
ISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWD
ESIETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQ
IRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERI
SHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVG
YSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTE
TSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESS
PRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVT
RKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGYSKVIKRVVLKSDTEQSEDNNE
NT seq 11874 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgaagatgcagctcagaaaagcgacagtggagagaagttcaacggcagtagt
cagaggagaaaaagacccaagaagtctgacagcaatgcaagcttcctccgtgctgccaga
gcaggcaacctggacaaagttgtggaatatctgaaggggggcatagacatcaatacctgc
aatcagaatggactcaacgctctccatctggctgccaaggaaggccacgtggggctggtg
caggagctgctgggaagagggtcctctgtggattctgccactaagaagggaaataccgct
cttcacattgcatctttggctggacaagcagaagttgtcaaagttcttgttaaggaagga
gccaatattaatgcacagtctcagaatggctttactcctttatacatggctgcccaagag
aatcacattgatgttgtaaaatatttgctggaaaatggagctaatcagagcactgctaca
gaggatggctttactcctctagctgtggcactccagcaaggacacaaccaggcggtggcc
atcctcttggagaatgacaccaaagggaaagtgaggctgccagctctgcatattgccgct
aggaaagacgacaccaaatctgccgcacttctgcttcagaatgaccacaatgctgacgta
caatccaagatgatggtgaataggacaactgagagtggttttacccctttgcacatagct
gcacattacggaaatgtcaacgtggcaactcttcttctaaaccggggagctgctgtggac
ttcacagccaggaatggaatcactcctctgcatgtggcttccaaaagaggaaatacaaac
atggtgaagctcttactggatcgaggcggtcagatcgatgccaaaactagggatgggttg
acaccacttcactgtgctgcacgaagtgggcatgaccaagtggtggaacttctgttggaa
cggggtgcccccttgctggcaaggactaagaatgggctgtctccactacacatggctgcc
cagggagaccacgtggaatgtgtgaagcacctgttacagcacaaggcacctgttgatgat
gtcaccctagactacctgacagccctccacgttgctgcgcactgtggccactaccgtgta
accaaactccttttagacaagagagccaatccgaacgccagagccctgaatggttttact
ccactgcacattgcctgcaagaaaaaccgcatcaaagtcatggaactgctggtgaaatat
ggggcttcaatccaagctataacagagtctggcctcacaccaatacatgtggctgccttc
atgggccacttgaacattgtcctccttctgctgcagaacggagcctctccagatgtcact
aacattcgtggtgagacggcactacacatggcagcccgagccgggcaggtggaagtggtc
cgatgcctcctgagaaatggtgcccttgttgatgccagagccagggaggaacagacacct
ttacatattgcctcccgcctgggtaagacagaaattgtccagctgcttctacaacatatg
gctcatccagatgcggccactacaaatgggtacacaccactgcacatctctgcccgggag
ggccaggtggatgtggcatcagtcctattggaagcaggagcagcccactccttagctacc
aagaagggttttactcccctgcatgtagcagccaagtatggaagcctggatgtggcaaaa
cttctcttgcaacgccgtgctgccgcagattctgcagggaagaacggccttaccccgctc
catgttgctgctcattatgacaaccagaaggtggcgctgctgttactggagaagggtgct
tcccctcatgccactgccaagaatggctatactccgttacatattgctgccaagaagaat
caaatgcagatagcttccacactcctgaactatggagcagagacaaacattgtgacaaag
caaggagtaactccactccatctggcctcgcaggaggggcacacagatatggttaccttg
cttctggataagggagccaatatccacatgtcaactaagagtggactcacatccttacac
cttgcagcccaggaagataaagtgaatgttgctgatattctcaccaagcatggagctgat
caggatgctcatacaaagcttggttacacacctttaattgtggcctgtcactatggaaat
gtgaaaatggtcaactttcttctgaagcagggagcaaatgttaacgcaaaaaccaagaac
ggctacacgcctttgcaccaggccgctcagcagggtcacacgcacatcatcaacgtcctg
ctccagcatggggccaagcccaacgccaccactgcgaatggcaacactgccttggcgatt
gctaagcgtctgggctacatctccgtggtcgacaccctgaaggttgtgactgaggaggtc
accaccaccaccacaactattacagaaaaacacaaactaaatgtacctgagacgatgact
gaggttcttgatgtttctgatgaagagggtgatgacacaatgactggtgatgggggagaa
taccttaggcctgaggacctaaaagaactgggtgatgactcactacccagcagtcagttc
ctggatggtatgaattacctgcgatacagcttggagggaggacgatctgacagccttcga
tccttcagttccgacaggtctcacactctgagccatgcctcctacctgagggacagtgcc
gtgatggatgactcagttgtgattcccagtcaccaggtgtcaactctagccaaggaggca
gaaaggaattcttatcgcctaagctggggcactgagaacttagacaacgtggctctttct
tctagtcctattcattcaggtttcctggttagttttatggtggatgcccgaggtggtgct
atgcgaggatgcagacacaatgggctccgaatcattattccacctcggaaatgtactgct
ccaacgcgagtcacctgccgactggtcaagcgccacagactggcaacaatgcctccaatg
gtggaaggagaaggcctggccagtcgcctgatcgaagttggaccttctggtgctcagttc
cttggtaaacttcacctgccaacggctcctcccccacttaatgagggagaaagtttggtc
agccgcattcttcagctggggcctcctggaaccaaattccttgggcctgtgatcgtggag
atccctcactttgcggcccttcgaggaaaggaaagggaactggtggtcctgcgcagtgag
aatggggacagctggaaagagcatttctgtgactacactgaagatgaattgaatgaaatt
cttaacggcatggatgaagtactggatagcccagaagacctagaaaagaaacgaatctgc
cgcatcatcacccgagacttcccacagtactttgcagtggtgtctcgtatcaaacaggac
agcaatctgattggcccagaaggaggtgtactgagcagcacagtggtgccccaggtgcag
gccgtcttcccagagggggcactcaccaagcggatccgcgtaggcctgcaggctcaacct
atgcacagtgagctggttaagaagatcctaggcaacaaagctaccttcagccctatagtc
actttggaacctagaagaagaaaattccacaaaccaattaccatgaccattcctgtcccc
aaagcttcaagtgatgtcatgttgaatggttttgggggagatgcaccaaccttaagatta
ctatgcagcataacaggtggaaccacccctgcccagtgggaagatattacaggaactacg
ccattaacatttgtcaatgaatgtgtttcctttacaacaaacgtgtctgccaggttctgg
ctgatagattgtcgacagatccaggaatccgttacttttgcatcacaagtatacagagaa
attatctgcgtaccttatatggccaaatttgtagtgtttgccaaatcacatgaccccatt
gaagccaggttgaggtgtttctgcatgactgatgataaagtggataagacccttgaacaa
caagaaaattttgctgaggtggccagaagcagggatgtggaggtgttagaaggaaaaccc
atctacgttgattgtttcggcaacttggtaccattaactaaaagtggccagcatcatata
ttcagtttttttgccttcaaagaaaatagacttcctctatttgtcaaggtacgcgatacg
actcaggaaccttgcggacgactatcatttatgaaggagccaaaatccacgagaggcctg
gtgcatcaagctatttgcaacttaaacatcactttgccgatttatacaaaggaatcagag
tcagatcaagaacaggaggaagagatcgatatgacatcagaaaaaaatgatgagacagaa
tctacagaaacatctgtcctgaaaagtcacctggttaatgaagttcctgtcctagcaagt
ccggacttgctctctgaagtttctgagatgaaacaagatttgatcaaaatgaccgccatc
ttgaccacagatgtgtctgataaggcaggttctattaaagtgaaggagctggtgaaggct
gctgaggaagagccaggagagccttttgaaatcgttgaaagagttaaagaggacttagag
aaagtgaatgaaatcctgagaagtggaacctgcacaagagatgaaagcagtgtgcagagc
tctcggtctgagagaggattagttgaagaggaatgggttattgtcagtgatgaggaaata
gaagaggctaggcaaaaagcacctttagaaatcactgaatatccatgtgtagaagttaga
atagataaagagatcaaaggaaaagtagagaaagactcaactgggctagtgaactacctt
actgatgatctgaatacctgtgtgcctcttcccaaagagcagctgcagacagttcaagat
aaggcagggaagaaatgtgaggctctggctgttggcaggagctctgaaaaggaagggaaa
gacatacccccagatgagacacagagtacacagaaacagcacaaaccaagcttgggaata
aagaagccagtaagaaggaaattaaaagaaaagcagaaacaaaaagaggaaggtttacaa
gctagtgcagagaaagctgaacttaaaaaaggtagttcagaagagtcattaggtgaagac
ccaggtttagcccctgaaccccttcccactgtcaaggccacatctcctttgatagaagaa
actcccattggttccataaaggacaaagtaaaggcccttcagaagcgagtggaagatgaa
cagaaaggtcgaagcaagttgcccatcagagtcaaaggcaaggaggacgtgccaaaaaag
accacccacaggccacatccagctgcgtcaccctctctgaagtcagagagacatgcgcca
gggtctccctcccctaaaacagaaagacactctactctttcctcttccgcaaaaactgaa
aggcaccctccagtatcaccatcaagtaaaactgagaaacactcacctgtgtcaccctct
gcaaaaacggaaagacattcacctgcgtcatcatcgagtaaaactgagaaacactcacct
gtatcaccctcgacaaaaactgaaaggcactctcctgtgtcatctacaaaaacagaaaga
cacccacctgtttcgccttcaggcaaaacagacaaacgtccacctgtatcgccctccggg
aggacagaaaaacacccgccagtatcgcctgggagaacagaaaaacgcttgcctgtttca
ccctccggaagaacggacaagcaccaacctgtatcaacagctgggaaaactgagaagcac
ctgcctgtgtcaccttctggcaaaacagaaaagcaaccacctgtatcccccacttcaaaa
acagagaggattgaggaaaccatgtctgttcgggagctgatgaaggctttccagtcaggt
caggacccttctaaacataaaactggactctttgagcacaaatcagcaaaacaaaagcag
ccacaagagaaaggtaaagttcgggtagaaaaagaaaaggggccgatactaacccagaga
gaagctcagaaaacagagaatcagacaatcaaacgaggccagagactcccggtaacgggc
acagcagaatccaaaagaggagttcgtgtttcctccataggagttaagaaagaagatgca
gctggaggaaaggagaaagttctcagccacaaaatacctgaacctgttcagtcagtgcct
gaagaagaaagccacagagagagcgaagtgcccaaagaaaagatggctgatgagcaggga
gacatggatctacagatcagcccagataggaaaacctccactgacttctctgaggtcatt
aagcaagagttggaagacaatgacaaataccaacaattccgcctgagtgaggagacagaa
aaggcacagcttcacttagaccaagtactcactagtcctttcaacacaacatttccactc
gactacatgaaagatgagttccttccagctctgtctttacaaagcggtgctttagatggc
agttctgaaagcctaaagaatgagggggtagccggctctccgtgtggcagcctgatggag
gggacccctcagattagttcagaagaaagctataagcatgaaggcctagcagagacccct
gagacgagcccagaaagcctttctttctcaccaaagaaaagtgaggagcaaactggggaa
acaaaggaaagcaccaagacagaaaccaccacagaaattcgttcagaaaaagagcatccc
acgaccaaagacattactggtggctctgaagagcgaggtgccacagtcactgaggactca
gagacctctactgagagttttcagaaagaggccactctaggctctcccaaagacacaagc
cctaaaagacaagatgattgcacaggcagctgtagtgtagcattagctaaagagacacct
acaggactgactgaggaggcagcctgtgatgaaggtcaacgtacctttggtagttcagcc
cacaagacacaaactgatagtgaggttcaagaatccacagccacctcagacgagacaaag
gccttgccgctgcctgaggcttctgtaaagacagatacaggaactgaatcaaaacctcag
ggagtcattagaagtccccaagggttagaacttgcactccctagccgagatagcgaagtc
ctcagcgctgtggctgatgactcattagcagtgagccacaaagactctctggaagccagc
cctgtgctagaagataactcttcacacaaaacccctgattctctggagccaagtcctctg
aaagaatccccttgccgtgactctctggaaagcagccctgttgaaccaaagatgaaggct
ggaatttttccaagtcactttcctcttcctgcagctgttgccaaaacagaactcttgacg
gaagtggcctctgtgcggtcccggctactccgagaccctgatggcagtgctgaggatgac
agtcttgagcagacatcgctcatggagagctcagggaagagccccctttctcctgacacc
cccagctctgaagaagtcagctatgaggttacacccaaaaccacagatgtaagtacacca
aaaccagctgtgattcatgaatgtgcagaggaggatgattcagaaaacggggagaaaaag
aggttcacacctgaagaggagatgtttaaaatggtaaccaaaatcaaaatgtttgatgaa
cttgaacaagaagcaaagcagaaaagggactacaaaaaagaacccaaacaagaagaatct
tcttcatcttctgacccagatgctgactgttcagtagatgtggatgaaccaaaacataca
ggcagtggggaggatgaaagtggtgtccctgtgttagtaacttcggagagcaggaaggtg
tcttcctcctcagaaagtgaacctgagttggcacagcttaaaaaaggtgctgactcaggc
cttttaccagaaccagtgattcgagtacaacctccttctccacttccatcaagcatggac
tccaattccagtccagaagaagtacaattccagcctgtcgtttccaaacaatatactttc
aagatgaatgaagatactcaggaagagccaggcaaatcagaagaagaaaaagattctgaa
tcccatttagctgaagaccgtcatgctgtttccactgaggctgaagacaggtcttatgat
aagctaaacagagacactgatcagccaaaaatctgtgatggccatggatgtgaggccatg
agtcctagcagctcagctgctcctgtctcttcaggtctacagagtccgactggtgatgat
gttgatgaacagccagtcatctataaagaatcattagctctccaaggcactcatgaaaaa
gacacagagggagaagagcttgatgtttctagagcagaatctccacaagcagattgcccc
agtgaaagcttttcatcttcatcctctttgcctcattgtttggtatctgaaggaaaagaa
ttagatgaagacatatctgccacatcttctattcaaaaaacagaggtcacaaaaactgat
gaaacatttgagaacttaccaaaggactgcccctctcaagactcatccattactactcaa
acagatagattttccatggatgttcccgtgtctgacctagctgagaatgatgaaatctat
gatccacaaatcactagcccttatgaaaatgtcccttcccaatcttttttctctagtgaa
gaaagcaaaacccaaacagatgcaaatcacaccacaagttttcactcttctgaagtgtat
tctgttaccatcacatcccctgttgaagacgttgtagtggcaagctcctctagtggaact
gttttaagcaaagaatctaattttgagggccaggacataaaaatggaatcccaacaggaa
agtaccttgtgggaaatgcaatcagacagtgtctcttcatctttcgagcctactatgtcc
gctacaacaacagttgttggtgaacaaataagcaaagtcatcatcacaaaaactgatgtg
gattctgattcttggagtgaaattcgggaagacgatgaagcctttgaggctcgtgtgaaa
gaggaagaacaaaagatatttggtttgatggtagacagacaatcacagggtaccacccct
gacaccactcctgctaggaccccaactgaagaggggaccccaacaagtgagcaaaaccca
tttctgtttcaggaaggaaaattgtttgaaatgacccgaagtggtgccattgatatgacc
aaaaggtcctatgcagatgaaagttttcactttttccaaattggtcaagaatccagggaa
gagactctctctgaagatgtgaaagaaggggctactggggctgatcccctaccgctggag
acatcagctgaatcactagcactttcagaatcaaaagaaacagtggatgatgaggcagac
ttacttccagatgacgtgagtgaggaagtagaggaaatacctgcttcggatgctcaactt
aactcccaaatggggatttcagcctccactgaaacacctacaaaagaagctgttagtgta
gggaccaaggacctccccaccgtgcaaacgggtgatatacctcctctctctggtgtaaag
cagatatcctgccccgactcttctgaaccagctgtacaagtccagttagatttttccaca
ctcaccaggtctgtttattcagataggggtgatgattctcccgattcttccccagaagaa
cagaaatcagtaatcgagattcctactgcacccatggagaatgtgccttttactgaaagc
aaatccaaaattcctgtaaggactatgcccacttccaccccagcacctccatctgcagag
tatgagagttcagtttctgaagattttctatccagtgtagatgaggaaaataaggcggat
gaagcaaaaccaaagtccaaactccctgtcaaagtacccctccaaagagttgaacagcag
ctctcagatctagacacctctgtccagaagacagtggctcctcagggacaggacatggca
agcatcgcaccagataatagaagcaaatctgaatctgatgctagttctttggattcaaag
accaaatgcccagtaaaaacccgaagttacactgagacagaaacagagagcagagagagg
gccgaggaacttgagttagaatcagaagaaggggccacaagaccaaagatacttacatcc
cgattgccagttaagagcagaagcactacatcttcctgcagggggggcacgagccccaca
aaagaaagtaaggagcatttctttgacctttacagaaattccatagaattctttgaggag
attagtgatgaggcttccaaattagtggataggctgacacagtcagagagggagcaggaa
atagtttcagacgatgaaagtagtagtgccctggaagtatcagtaattgaaaatctgcca
cctgttgagaccgagcactcagttcctgaggacatctttgacacaaggcccatttgggat
gagtctattgagactctgattgaacgcatccctgatgaaaatggccatgaccatgctgaa
gatccacaggatgagcaggaacggatcgaggaaaggctggcttatattgctgatcacctt
ggcttcagctggacagaattagcaagagaactggatttcactgaggagcaaattcatcaa
attcgaattgaaaatcccaactctcttcaagaccagagtcatgcactgttgaagtactgg
ctagagagggatgggaaacatgctacagataccaacctcgttgaatgtctcaccaagatc
aaccgaatggatattgttcatctcatggagaccaacacagaacctctccaggagcgcatc
agtcatagttatgcagaaattgaacagaccattacactggatcatagtgaagggttctcg
gtacttcaagaggagttatgcactgcacagcacaagcagaaagaggagcaagctgtttct
aaagaaagtgagacctgcgatcaccctcctatcgtctcagaggaagacatttctgttggt
tattccacttttcaggatggcgtccccaaaactgagggggacagctcagcaacagcactc
tttccccaaactcacaaggagcaagttcaacaggatttctcagggaaaatgcaagacctg
cctgaagagtcatctctggaatatcagcaggaatattttgtgacaactccaggaacagaa
acatcagagactcagaaggctatgatagtacccagctctcccagcaagacacctgaggaa
gttagcacccctgcagaggaggagaagctgtacctccagaccccaacatccagcgagcgg
ggaggctctcccatcatacaagaacccgaagagccctcagagcacagagaggagagctct
ccgcggaaaaccagcctcgtaatagtggagtctgccgataaccagcctgagacctgtgaa
agactcgatgaagatgcagcttttgaaaagggagacgatatgcctgaaatacccccagaa
acagtcacagaagaagaatacattgatgagcatggacacaccgtggtaaagaaggttact
aggaaaatcattaggcggtatgtatcctctgaaggcacagagaaagaagagattatggtg
cagggaatgccacaggaacctgtcaacatcgaggaaggggatggctattccaaagttata
aagcgtgttgtattgaagagtgacaccgagcagtcagaggacaacaatgagtaa

KEGG   Homo sapiens (human): 288Help
Entry
288               CDS       T01001                                 

Gene name
ANK3, ANKYRIN-G, MRT37
Definition
(RefSeq) ankyrin 3
  KO
K10380  ankyrin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05205  Proteoglycans in cancer
Disease
H00768  Autosomal recessive mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    288 (ANK3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    288 (ANK3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    288 (ANK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 UPA_2 ZU5 Death
Motif
Other DBs
NCBI-GeneID: 288
NCBI-ProteinID: NP_066267
OMIM: 600465
HGNC: 494
Ensembl: ENSG00000151150
Vega: OTTHUMG00000018288
Pharos: Q12955(Tbio)
UniProt: Q12955
LinkDB All DBs
Structure
PDB: 

Position
10q21.2
AA seq 4377 aa AA seqDB search
MAHAASQLKKNRDLEINAEEEPEKKRKHRKRSRDRKKKSDANASYLRAARAGHLEKALDY
IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQA
EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVA
LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLH
IAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD
GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPV
DDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL
KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAE
VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSA
REGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLT
PLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAV
TRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG
AHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIIN
VLLQNNASPNELTVNGNTALGIARRLGYISVVDTLKIVTEETMTTTTVTEKHKMNVPETM
NEVLDMSDDEVRKANAPEMLSDGEYISDVEEGEDAMTGDTDKYLGPQDLKELGDDSLPAE
GYMGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSL
RHYSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI
TCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVL
RSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRI
KQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFS
PIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDI
TGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKM
NDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGG
QQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHK
KETESDQDDEIEKTDRRQSFASLALRKRYSYLTEPGMIERSTGATRSLPTTYSYKPFFST
RPYQSWTTAPITVPGPAKSGFTSLSSSSSNTPSASPLKSIWSVSTPSPIKSTLGASTTSS
VKSISDVASPIRSFRTMSSPIKTVVSQSPYNIQVSSGTLARAPAVTEATPLKGLASNSTF
SSRTSPVTTAGSLLERSSITMTPPASPKSNINMYSSSLPFKSIITSAAPLISSPLKSVVS
PVKSAVDVISSAKITMASSLSSPVKQMPGHAEVALVNGSISPLKYPSSSTLINGCKATAT
LQEKISSATNSVSSVVSAATDTVEKVFSTTTAMPFSPLRSYVSAAPSAFQSLRTPSASAL
YTSLGSSISATTSSVTSSIITVPVYSVVNVLPEPALKKLPDSNSFTKSAAALLSPIKTLT
TETHPQPHFSRTSSPVKSSLFLAPSALKLSTPSSLSSSQEILKDVAEMKEDLMRMTAILQ
TDVPEEKPFQPELPKEGRIDDEEPFKIVEKVKEDLVKVSEILKKDVCVDNKGSPKSPKSD
KGHSPEDDWIEFSSEEIREARQQAAASQSPSLPERVQVKAKAASEKDYNLTKVIDYLTND
IGSSSLTNLKYKFEDAKKDGEERQKRVLKPAIALQEHKLKMPPASMRTSTSEKELCKMAD
SFFGTDTILESPDDFSQHDQDKSPLSDSGFETRSEKTPSAPQSAESTGPKPLFHEVPIPP
VITETRTEVVHVIRSYDPSAGDVPQTQPEEPVSPKPSPTFMELEPKPTTSSIKEKVKAFQ
MKASSEEDDHNRVLSKGMRVKEETHITTTTRMVYHSPPGGEGASERIEETMSVHDIMKAF
QSGRDPSKELAGLFEHKSAVSPDVHKSAAETSAQHAEKDNQMKPKLERIIEVHIEKGNQA
EPTEVIIRETKKHPEKEMYVYQKDLSRGDINLKDFLPEKHDAFPCSEEQGQQEEEELTAE
ESLPSYLESSRVNTPVSQEEDSRPSSAQLISDDSYKTLKLLSQHSIEYHDDELSELRGES
YRFAEKMLLSEKLDVSHSDTEESVTDHAGPPSSELQGSDKRSREKIATAPKKEILSKIYK
DVSENGVGKVSKDEHFDKVTVLHYSGNVSSPKHAMWMRFTEDRLDRGREKLIYEDRVDRT
VKEAEEKLTEVSQFFRDKTEKLNDELQSPEKKARPKNGKEYSSQSPTSSSPEKVLLTELL
ASNDEWVKARQHGPDGQGFPKAEEKAPSLPSSPEKMVLSQQTEDSKSTVEAKGSISQSKA
PDGPQSGFQLKQSKLSSIRLKFEQGTHAKSKDMSQEDRKSDGQSRIPVKKIQESKLPVYQ
VFAREKQQKAIDLPDESVSVQKDFMVLKTKDEHAQSNEIVVNDSGSDNVKKQRTEMSSKA
MPDSFSEQQAKDLACHITSDLATRGPWDKKVFRTWESSGATNNKSQKEKLSHVLVHDVRE
NHIGHPESKSVDQKNEFMSVTERERKLLTNGSLSEIKEMTVKSPSKKVLYREYVVKEGDH
PGGLLDQPSRRSESSAVSHIPVRVADERRMLSSNIPDGFCEQSAFPKHELSQKLSQSSMS
KETVETQHFNSIEDEKVTYSEISKVSKHQSYVGLCPPLEETETSPTKSPDSLEFSPGKES
PSSDVFDHSPIDGLEKLAPLAQTEGGKEIKTLPVYVSFVQVGKQYEKEIQQGGVKKIISQ
ECKTVQETRGTFYTTRQQKQPPSPQGSPEDDTLEQVSFLDSSGKSPLTPETPSSEEVSYE
FTSKTPDSLIAYIPGKPSPIPEVSEESEEEEQAKSTSLKQTTVEETAVEREMPNDVSKDS
NQRPKNNRVAYIEFPPPPPLDADQIESDKKHHYLPEKEVDMIEVNLQDEHDKYQLAEPVI
RVQPPSPVPPGADVSDSSDDESIYQPVPVKKYTFKLKEVDDEQKEKPKASAEKASNQKEL
ESNGSGKDNEFGLGLDSPQNEIAQNGNNDQSITECSIATTAEFSHDTDATEIDSLDGYDL
QDEDDGLTESDSKLPIQAMEIKKDIWNTEGILKPADRSFSQSKLEVIEEEGKVGPDEDKP
PSKSSSSEKTPDKTDQKSGAQFFTLEGRHPDRSVFPDTYFSYKVDEEFATPFKTVATKGL
DFDPWSNNRGDDEVFDSKSREDETKPFGLAVEDRSPATTPDTTPARTPTDESTPTSEPNP
FPFHEGKMFEMTRSGAIDMSKRDFVEERLQFFQIGEHTSEGKSGDQGEGDKSMVTATPQP
QSGDTTVETNLERNVETPTVEPNPSIPTSGECQEGTSSSGSLEKSAAATNTSKVDPKLRT
PIKMGISASTMTMKKEGPGEITDKIEAVMTSCQGLENETITMISNTANSQMGVRPHEKHD
FQKDNFNNNNNLDSSTIQTDNIMSNIVLTEHSAPTCTTEKDNPVKVSSGKKTGVLQGHCV
RDKQKVLGEQQKTKELIGIRQKSKLPIKATSPKDTFPPNHMSNTKASKMKQVSQSEKTKA
LTTSSCVDVKSRIPVKNTHRDNIIAVRKACATQKQGQPEKGKAKQLPSKLPVKVRSTCVT
TTTTTATTTTTTTTTTTTSCTVKVRKSQLKEVCKHSIEYFKGISGETLKLVDRLSEEEKK
MQSELSDEEESTSRNTSLSETSRGGQPSVTTKSARDKKTEAAPLKSKSEKAGSEKRSSRR
TGPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKK
WVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDGW
QNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSYLKGEAGKFEANGSHTEITPE
AKTKSYFPESQNDVGKQSTKETLKPKIHGSGHVEEPASPLAAYQKSLEETSKLIIEETKP
CVPVSMKKMSRTSPADGKPRLSLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKSHS
NT seq 13134 nt NT seq  +upstreamnt  +downstreamnt
atggctcatgcagcctcacaattaaagaaaaacagggatttagaaatcaatgctgaagaa
gagcctgagaaaaaaaggaaacaccgcaaacggtcccgggatcggaagaaaaagtctgat
gccaatgcaagttacttaagagcagctcgagctggacaccttgaaaaggccctcgactac
ataaaaaatggagttgacatcaacatttgcaatcagaatgggttgaacgctctccacctt
gcttccaaagaaggccatgtagaggttgtttctgagctgctgcagagagaagccaatgtg
gatgcagctacaaagaaaggaaacacagcattgcacatcgcatctttggctgggcaagca
gaggtggtaaaagtcttggttacaaatggagccaatgtcaatgcacaatctcagaatggt
ttcacgccattgtatatggcagcccaggaaaatcacctggaagttgtcaagtttcttctt
gacaatggtgcaagccagagcctagccacagaggatggcttcacaccattggcagtggct
ttgcaacaaggtcacgaccaagtcgtttcgctcctgctagagaatgacaccaaaggaaaa
gtgcgtctcccagctcttcatatcgcggcccgaaaagacgacacgaaagccgccgccctg
ctgctgcagaatgacaacaatgcagatgtggaatcaaagagtggcttcactccgctccac
atagctgctcactatggaaatatcaatgtagccacgttgctgttaaaccgagcggctgct
gtggatttcaccgcaaggaatgacatcactcctttacatgttgcatcaaaaagaggaaat
gcaaatatggtaaaactattgctcgatcgaggagctaaaatcgatgccaaaaccagggat
ggtctgacaccactgcactgtggagcaaggagtggccacgagcaggtggtagaaatgttg
cttgatcgagctgcccccattctttcaaaaaccaagaatggattatctccattgcacatg
gccacacaaggggatcatttaaactgcgtccagcttctcctccagcataatgtacccgtg
gatgatgtcaccaatgactacctgactgccctacacgtggctgcccactgtggccattac
aaagttgccaaggttctcttggataagaaagctaaccccaatgccaaagccctgaatggc
tttacccctcttcatattgcctgcaagaagaatcgaattaaagtaatggaactccttctg
aaacacggtgcatccatccaagctgtaaccgagtcgggccttaccccaatccatgttgct
gccttcatggggcatgtaaatattgtatcacaactaatgcatcatggagcctcaccaaac
accaccaatgtgagaggagaaacagcactgcacatggcagctcgctccggccaagctgaa
gttgtgcggtatctggtacaagacggagctcaggtagaagctaaagctaaggatgaccaa
acaccactccacatttcagcccgactggggaaagcagacatagtacaacagctgttgcag
caaggggcatctccaaatgcagccacaacttctgggtacaccccacttcacctttccgcc
cgagaggggcatgaggatgtggccgcgttccttttggatcatggagcgtctttatctata
acaacaaagaaaggatttactcctcttcatgtggcagcaaaatatggaaagcttgaagtc
gccaatctcctgctacagaaaagtgcatctccagatgctgctgggaagagcgggctaaca
ccactgcatgtagctgcacattacgataatcagaaagtggcccttctgcttttggaccaa
ggagcctcacctcacgcagccgcaaagaatggttatacgccactgcacatcgctgccaaa
aagaaccagatggacatagcgacaactctgctggaatatggtgctgatgccaacgcagtt
acccggcaaggaattgcttccgtccatctcgcagctcaggaagggcacgtggacatggtg
tcgctgctcctcggtagaaatgcgaatgtgaacctgagcaataagagcggcctgacccca
ctccatttggctgctcaagaagatcgagtgaatgtggcagaagtcctcgtaaaccaaggg
gctcatgtggacgcccagacaaagatgggatacacaccactgcatgtgggctgccactat
ggaaatatcaagattgttaatttcctgctccagcattctgcaaaagttaatgccaaaaca
aagaatgggtatacgccattacatcaagcagcacagcaggggcatacgcatataataaat
gtcttacttcagaacaacgcctcccccaatgaactcactgtgaatgggaatactgccctt
ggcattgcccggcgcctcggctacatctcagtagtggacaccctgaagatagtgaccgaa
gagaccatgaccacaactactgtcacagagaagcacaaaatgaatgttccagaaacgatg
aatgaagttcttgatatgtctgatgatgaagttcgtaaagccaatgcccctgaaatgctc
agtgatggcgaatatatctcagatgttgaagaaggtgaagatgcaatgaccggggacaca
gacaaatatcttgggccacaggaccttaaggaattgggtgatgattccctgcctgcagag
ggttacatgggctttagtctcggagcgcgttctgccagcctccgctccttcagttcggat
aggtcttacaccttgaacagaagctcctatgcacgggacagcatgatgattgaagaactc
cttgtgccatccaaagagcagcatctaacattcacaagggaatttgattcagattctctt
agacattacagctgggctgcagacaccttagacaatgtcaatcttgtttcaagccccatt
cattctgggtttctggttagctttatggtggacgcgagagggggctccatgagaggaagc
cgtcatcacgggatgagaatcatcattcctccacgcaagtgtacggcccccactcgaatc
acctgccgtttggtaaagagacataaactggccaacccaccccccatggtggaaggagag
ggattagccagtaggctggtagaaatgggtcctgcaggggcacaatttttaggccctgtc
atagtggaaatccctcactttgggtccatgagaggaaaagagagagaactcattgttctt
cgaagtgaaaatggtgaaacttggaaggagcatcagtttgacagcaaaaatgaagattta
accgagttacttaatggcatggatgaagaacttgatagcccagaagagttagggaaaaag
cgtatctgcaggattatcacgaaagatttcccccagtattttgcagtggtttcccggatt
aagcaggaaagcaaccagattggtcctgaaggtggaattctgagcagcaccacagtgccc
cttgttcaagcatctttcccagagggtgccctaactaaaagaattcgagtgggcctccag
gcccagcctgttccagatgaaattgtgaaaaagatccttggaaacaaagcaacttttagc
ccaattgtcactgtggaaccaagaagacggaaattccataaaccaatcacaatgaccatt
ccggtgcccccgccctcaggagaaggtgtatccaatggatacaaaggggacactacaccc
aatctgcgtcttctctgtagcattacagggggcacttcgcctgctcagtgggaagacatc
acaggaacaactcctttgacgtttataaaagattgtgtctcctttacaaccaatgtttca
gccagattttggcttgcagactgccatcaagttttagaaactgtggggttagccacgcaa
ctgtacagagaattgatatgtgttccatatatggccaagtttgttgtttttgccaaaatg
aatgatcccgtagaatcttccttgcgatgtttctgcatgacagatgacaaagtggacaaa
actttagagcaacaagagaattttgaggaagtcgcaagaagcaaagatattgaggttctg
gaaggaaaacctatttatgttgattgttatggaaatttggccccacttaccaaaggagga
cagcaacttgtttttaacttttattctttcaaagaaaatagactgccattttccatcaag
attagagacaccagccaagagccctgtggtcgtctgtcttttctgaaagaaccaaagaca
acaaaaggactgcctcaaacagcggtttgcaacttaaatatcactctgccagcacataaa
aaggagacagagtcagatcaagatgatgagattgagaaaacagatagacgacagagcttc
gcatccttagctttacgtaagcgctacagctacttgactgagcctggaatgattgaacgg
agtacaggagcaacaagatccctccccaccacttactcatacaagccattcttttctaca
agaccataccagtcctggacaacagctccgattacagtgcctgggccagccaagtcaggc
ttcacttccttatcaagttcttcctctaatacgccatcagcttctccgttaaaatcaata
tggtctgtttcgacaccttctccaatcaaatccacattaggcgcgtcaactacatcttca
gttaaatccattagtgacgtggcatctccaattagatcctttcggacaatgtcttcgccg
ataaaaactgtggtgtcacaatctccatacaatatccaagtttcctctggtaccctggct
agagctccagcagtcacggaagctacgcccttaaaagggctggcatccaattctacgttt
tcctctcgaacctctccagtgactacagcagggtctcttttggagaggtcatcaattact
atgacaccccctgcctcccccaaatcaaacattaatatgtattcctcaagtttgccattt
aagtcaattattacatcagcagcaccgctaatatcttcacctttaaagtcagtggtgtct
ccagttaaatcagcagttgatgtcatttcatcagccaaaattacaatggcatcttctctc
tcatcacctgtgaagcagatgcctggacatgcagaggtagcattagtcaatggatctatt
tcccctctaaaatatccatcatcctcaactttaattaatggatgcaaagccactgccacg
ttacaggaaaaaatttcttctgctacaaactctgtgagctctgtggtcagtgcagccact
gacacagttgagaaagtgttttctaccacgactgcaatgccattttccccactcaggtca
tatgtttctgcagcaccatcagcttttcagtctctaagaactccttccgcaagtgcactc
tatacatcccttgggtcgtcaatatctgcaactacctcatctgtaacttcatcaattata
acagtgccagtatactctgtagtcaatgttttgccagaaccagcattaaagaaacttcca
gactctaattcatttacaaaatcagcagcagccttgctgtcacccattaaaacattgact
acggagacacatcctcagcctcacttcagtcgaacttcatctccagttaagtcatctttg
ttccttgcaccctctgcccttaagttgtctacaccatcttctttatcttccagtcaggag
atactaaaagatgtagctgaaatgaaagaggacctaatgcggatgaccgcaatactacag
acagatgtgcctgaggagaagccattccaacctgaactcccaaaggaagggagaatagat
gatgaagaacctttcaaaattgtagagaaagtaaaggaagacttagtgaaagttagtgaa
atccttaaaaaggatgtatgtgtagataataaaggatcacccaaatcaccaaagagtgac
aaaggacactctcctgaagatgactggatagaatttagttcggaagaaatccgggaagcc
agacaacaagctgctgcgagccagtctccatctctgccagagagagtgcaagtaaaagca
aaagccgcctccgaaaaggattataacttgaccaaagttattgattacctaacaaatgat
attgggagtagttcactgacaaacttaaaatacaagtttgaggatgcaaagaaggatggt
gaggagagacagaaaagagttttaaaaccagcaattgctttgcaggaacacaaactcaaa
atgcctccagcctccatgaggacttccacctctgagaaagaattgtgtaaaatggctgat
tccttttttggaacagatactattttagagtctcctgatgacttttctcaacacgaccaa
gataaaagtcccttgtctgacagtggctttgaaacaagaagtgaaaagacaccttcagcc
ccacaaagcgctgaaagcactggtcctaaaccactttttcatgaagttcccatccctcct
gtcattacagaaacaagaactgaagtggttcatgttatcaggagctatgatccctcagct
ggggatgttccccagacccaaccagaggagcctgtgtcacctaaaccttcacctactttt
atggaattggaaccaaagcccaccacctctagtattaaagaaaaggttaaagcatttcaa
atgaaagccagtagtgaagaagatgaccacaatcgggttttaagcaaaggcatgcgtgtt
aaagaagagactcacataaccacaaccaccagaatggtttatcattctccaccaggcggt
gaaggtgcatctgaaagaattgaagaaaccatgtcagtccatgacatcatgaaggccttt
cagtccgggcgggatccttccaaagaactggcaggtctgtttgaacataagtcggcagtg
tctccagatgttcacaagtctgctgctgaaacctcagcccagcatgcagagaaggacaac
caaatgaaacccaaactggagcgtataatagaagtccacatcgaaaaaggtaaccaagct
gagcccactgaagtcattattagagaaaccaaaaagcatccagaaaaagaaatgtatgta
tatcagaaagacttatcccggggagatattaacctaaaagattttctgccagaaaaacac
gatgcttttccttgttcagaggaacagggtcagcaagaagaagaagaacttactgctgaa
gagtcattgccttcttatctggagtcttccagagtaaacactcctgtgtcccaagaagaa
gatagccgccctagttctgctcaactcatatctgatgactcttataaaacattgaagctt
ttgagtcaacactcaatagaataccatgacgatgagttgtcagaactaagaggggagtct
tacaggtttgctgagaaaatgcttctgtcagaaaagctagatgtgtctcattctgatact
gaggaatcggttacagaccatgcaggaccccctagctcagagttacaggggtctgataag
cggtccagagaaaaaatagccactgcccccaaaaaagaaattctctccaaaatctataaa
gatgtttctgaaaatggtgtaggtaaagtgtctaaagatgagcattttgataaagtgaca
gtgttgcactattctggcaatgttagtagtccaaaacatgccatgtggatgcgctttact
gaggacagattagacagaggtagagagaagttgatatatgaagatagggtggacaggact
gtgaaggaggctgaagaaaaactgactgaagtgtcacagttttttcgtgacaaaactgaa
aagctaaatgatgaactgcagtccccagagaaaaaggcacgccctaaaaatggcaaagaa
tattcttctcaaagccctaccagtagcagccctgagaaagtgctactgacagaactgctg
gcatccaatgatgagtgggttaaggcaagacagcatggccctgatggacaaggcttcccc
aaggccgaggagaaggcacccagtctgcccagcagcccagagaagatggttctctcccaa
cagactgaggacagcaagtccacagtggaagccaaaggaagtatttcacagagcaaagca
ccagatgggccccagtctggattccagctcaaacaatctaaactcagttccattagatta
aaatttgaacaaggcacacacgcaaaaagtaaggacatgtctcaagaagacagaaagtca
gatggccagtccagaatcccagttaaaaaaatacaggagagcaagctacccgtctaccaa
gtttttgctagagaaaaacagcagaaggccatagacctcccagatgaaagtgtatctgtg
caaaaagattttatggtattaaaaaccaaagatgagcatgcccaaagcaacgaaattgtt
gtaaatgattctggctctgataatgtgaaaaaacagagaactgaaatgtcaagtaaagca
atgcctgactctttttctgagcagcaggctaaagacttggcatgtcatataacctcagat
ttagcaactaggggaccatgggacaaaaaggtctttagaacatgggagagttcgggagcc
actaacaataagtctcagaaagaaaaactttcgcatgtacttgttcatgatgtaagagag
aatcacattggtcaccctgagagtaaaagtgttgatcaaaagaatgaatttatgtctgtg
actgagagagaacgcaaattgttaacaaacggctctctctcagaaattaaagaaatgact
gtaaaatctccctccaaaaaagtcttatatagggaatatgttgtgaaagaaggggaccat
ccaggcggattgcttgatcagccttccaggaggagcgagagctcagcagtgtcacacatt
cccgtcagagttgctgatgagaggagaatgctgtcttctaatattcccgatggtttttgt
gaacagtcggcatttccaaaacatgaactatcacaaaaattgtcccagtcaagcatgagt
aaagagacagttgagacacagcactttaattctatagaagatgaaaaagttacctattca
gaaatcagcaaagtttccaaacaccagagttatgtaggtttatgcccacctctcgaggaa
accgaaacctcccccaccaaatctcctgattctttagagtttagcccaggaaaggaatct
ccctctagtgatgtattcgaccacagtcccattgatggattggaaaaactcgcaccacta
gcccagacagagggagggaaagagataaaaactttacccgtttatgtcagttttgtacaa
gtggggaagcaatatgaaaaggagatacaacaaggaggtgtaaaaaaaatcataagtcag
gaatgtaagacagtacaagaaaccagggggaccttttatacaactagacagcaaaagcaa
cctccttctccccaaggtagtccagaagatgatactctagagcaagtatcctttctagac
agctctgggaaaagccctttaaccccagaaacacccagttcagaggaagtgagttatgaa
tttacatctaagacacctgactcgctcatagcttatataccaggcaaacccagcccaatt
cccgaggtttctgaggagtcagaggaggaggaacaggccaagtcaacctcccttaagcag
actacagtggaggaaacagcagttgagcgtgaaatgcctaatgacgtgagcaaagactct
aaccaaagacccaaaaataacagagttgcctatattgaatttccccctcctccaccactg
gatgcggaccagattgagtcagataagaagcatcattatctcccagaaaaagaggttgac
atgattgaagtcaatctgcaagatgagcatgacaagtaccagctggctgaacctgtcatt
agagtgcagccaccttcaccagttcctcccggggcagacgtcagtgattcaagcgatgac
gaatctatttatcagccagtcccagttaaaaaatataccttcaaattaaaggaagtggac
gatgaacaaaaagaaaaacccaaagcttctgctgaaaaggcttccaaccagaaagaactg
gaaagtaatggatctggaaaagataatgaatttggccttggccttgattcacctcagaat
gaaattgcccagaatgggaacaacgaccagtccatcacagagtgttccattgccaccaca
gcagagttttctcatgacacggatgccacagagatcgactctctggatggctatgacctg
caagatgaagatgatggcttgacagagagtgattctaaactcccaattcaagccatggaa
attaagaaagatatctggaacacagagggcattctgaagccagctgaccgctcttttagc
caaagtaaacttgaagttatcgaggaggagggaaaggtgggaccagatgaggacaagcca
ccttctaaaagttcttcatctgaaaagactcctgataagactgatcagaagtcaggggcc
cagttcttcacactggaaggcagacatcctgacagatcagtgtttcctgatacttacttc
agttacaaagtagatgaagaatttgccactccttttaaaacagtagctaccaaaggtcta
gattttgacccttggtctaataaccgaggggatgatgaagtttttgacagtaaatcacgg
gaagatgaaactaagccatttgggctggcggtagaagaccgctctccagcaacaacccct
gatacaacgccagccagaacgccaactgatgaaagtaccccaactagtgagcctaacccc
ttcccatttcatgaaggaaaaatgtttgagatgactcgcagtggtgcaattgacatgagc
aagagggattttgttgaagagaggctccaatttttccagattggtgagcatacttctgaa
gggaagtcaggggaccagggggaaggggataaaagtatggtcactgccacaccacagcca
cagtcaggggacaccactgtagaaaccaatctagagagaaatgtagagacacctacagtg
gaacctaaccccagcatcccgaccagcggagagtgtcaggaaggcacatccagtagtggc
tccctggagaaatcagcagcagccactaacacctctaaagttgaccccaagttgcgcacg
cctataaaaatgggaatttctgcatccaccatgaccatgaagaaagaaggccctggagaa
ataacagataagatagaagcggtgatgaccagttgtcagggattagaaaatgaaactata
acaatgatttcaaatacagccaatagccagatgggcgttaggccccatgaaaaacatgat
tttcaaaaagataactttaataacaacaacaatttggattcttccactatacagacagat
aacattatgagtaatatagttctgacagaacattctgcacccacttgtaccacagagaaa
gataacccagtgaaagtctcatcaggaaaaaagacaggggtactacaaggacactgtgta
agagataagcagaaagttcttggagaacagcaaaaaacaaaggaattgatagggattagg
caaaaatccaaacttcccataaaggccacttcaccaaaagataccttcccaccgaaccat
atgtcaaacactaaagcaagtaaaatgaagcaggttagtcaatccgagaaaaccaaagcc
cttactacttcttcatgtgtagatgtaaagtccagaattccagtgaaaaacacacacagg
gataacataattgcagttagaaaagcatgtgccacacaaaagcaagggcagccagagaaa
ggcaaggccaaacagcttccatccaagttgccagtaaaggtaagatccacctgtgtcact
accaccaccaccactgccaccaccaccaccactaccaccactaccaccaccaccagctgc
acagttaaagttaggaaaagtcagctcaaggaagtatgtaaacattccattgaatatttt
aagggaattagtggtgagaccttaaagcttgtggaccgcctctctgaagaagaaaaaaag
atgcagtccgagttgtccgatgaggaagaaagtacctcaagaaacacgtcgttgtccgag
acttcccggggtggccagccttcggttacaacgaagtctgctagagataagaaaacagag
gcagcacctttaaaatcaaagagtgaaaaggccggcagtgagaaaaggagcagtagaagg
actggtccacagagtccatgtgaacggacagatatcaggatggcaatagtagccgatcac
ctgggacttagttggacagaactggcaagggaactgaatttttcagtggatgaaatcaat
caaatacgtgtggaaaatccaaattctttaatttctcagagcttcatgttattaaaaaaa
tgggttaccagagacggaaaaaatgccacaactgatgccttaacttcggtcttgacaaaa
attaatcgaatagatatagtgacactgctagaaggaccaatatttgattatggaaatatt
tcaggcaccagaagttttgcagatgagaacaatgttttccatgaccctgttgatggttgg
cagaatgagacatcaagtggaaacctagagtcctgcgctcaagctcgaagagtaactggt
gggttactagatcgactggatgacagccctgaccagtgtagagattccattacctcatat
ctcaaaggagaagctggcaaatttgaagcaaatggaagccatacagaaatcactccagaa
gcaaagacaaaatcttactttccagaatcccaaaatgatgtaggaaaacagagtaccaag
gaaactctgaaaccaaaaatacatggatctggtcatgttgaagaaccagcatcaccacta
gcagcatatcagaaatctctagaagaaaccagcaagcttataatagaagagactaaaccc
tgtgtgcctgtcagtatgaaaaagatgagtaggacttctccagcagatggcaagccaagg
cttagcctccatgaagaagaggggtccagtgggtctgagcaaaagcagggagaaggtttt
aaggtgaaaacgaagaaagaaatccggcatgtggaaaagaagagccactcgtaa

DBGET integrated database retrieval system