KEGG   Homo sapiens (human): 2862Help
Entry
2862              CDS       T01001                                 

Gene name
MLNR, GPR38, MTLR1
Definition
(RefSeq) motilin receptor
  KO
K05266  motilin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Alemcinal: D02801
Atilmotin: D03216
Camicinal: D10330
Idremcinal: D04497
Mitemcinal fumarate: D05053
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2862 (MLNR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2862 (MLNR)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Motilin
    2862 (MLNR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 2862
NCBI-ProteinID: NP_001498
OMIM: 602885
HGNC: 4495
Ensembl: ENSG00000102539
Vega: OTTHUMG00000016909
Pharos: O43193(Tchem)
UniProt: O43193
LinkDB All DBs
Position
13q14.2
AA seq 412 aa AA seqDB search
MGSPWNGSDGPEGAREPPWPALPPCDERRCSPFPLGALVPVTAVCLCLFVVGVSGNVVTV
MLIGRYRDMRTTTNLYLGSMAVSDLLILLGLPFDLYRLWRSRPWVFGPLLCRLSLYVGEG
CTYATLLHMTALSVERYLAICRPLRARVLVTRRRVRALIAVLWAVALLSAGPFLFLVGVE
QDPGISVVPGLNGTARIASSPLASSPPLWLSRAPPPSPPSGPETAEAAALFSRECRPSPA
QLGALRVMLWVTTAYFFLPFLCLSILYGLIGRELWSSRRPLRGPAASGRERGHRQTVRVL
LVVVLAFIICWLPFHVGRIIYINTEDSRMMYFSQYFNIVALQLFYLSASINPILYNLISK
KYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGDTVGYTETSANVKTMG
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcccctggaacggcagcgacggccccgagggggcgcgggagccgccgtggccc
gcgctgccgccttgcgacgagcgccgctgctcgccctttcccctgggggcgctggtgccg
gtgaccgctgtgtgcctgtgcctgttcgtcgtcggggtgagcggcaacgtggtgaccgtg
atgctgatcgggcgctaccgggacatgcggaccaccaccaacttgtacctgggcagcatg
gccgtgtccgacctactcatcctgctcgggctgccgttcgacctgtaccgcctctggcgc
tcgcggccctgggtgttcgggccgctgctctgccgcctgtccctctacgtgggcgagggc
tgcacctacgccacgctgctgcacatgaccgcgctcagcgtcgagcgctacctggccatc
tgccgcccgctccgcgcccgcgtcttggtcacccggcgccgcgtccgcgcgctcatcgct
gtgctctgggccgtggcgctgctctctgccggtcccttcttgttcctggtgggcgtcgag
caggaccccggcatctccgtagtcccgggcctcaatggcaccgcgcggatcgcctcctcg
cctctcgcctcgtcgccgcctctctggctctcgcgggcgccaccgccgtccccgccgtcg
gggcccgagaccgcggaggccgcggcgctgttcagccgcgaatgccggccgagccccgcg
cagctgggcgcgctgcgtgtcatgctgtgggtcaccaccgcctacttcttcctgcccttt
ctgtgcctcagcatcctctacgggctcatcgggcgggagctgtggagcagccggcggccg
ctgcgaggcccggccgcctcggggcgggagagaggccaccggcagaccgtccgcgtcctg
ctggtggtggttctggcatttataatttgctggttgcccttccacgttggcagaatcatt
tacataaacacggaagattcgcggatgatgtacttctctcagtactttaacatcgtcgct
ctgcaacttttctatctgagcgcatctatcaacccaatcctctacaacctcatttcaaag
aagtacagagcggcggcctttaaactgctgctcgcaaggaagtccaggccgagaggcttc
cacagaagcagggacactgcgggggaagttgcaggggacactggaggagacacggtgggc
tacaccgagacaagcgctaacgtgaagacgatgggataa

DBGET integrated database retrieval system