KEGG   Homo sapiens (human): 28973Help
Entry
28973             CDS       T01001                                 

Gene name
MRPS18B, C6orf14, HSPC183, HumanS18a, MRP-S18-2, MRPS18-2, PTD017, S18amt
Definition
(RefSeq) mitochondrial ribosomal protein S18B
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
hsa  Homo sapiens (human)
Pathway
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    28973 (MRPS18B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    28973 (MRPS18B)
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    28973 (MRPS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S18 HTH_21 zf-RING_10
Motif
Other DBs
NCBI-GeneID: 28973
NCBI-ProteinID: NP_054765
OMIM: 611982
HGNC: 14516
Ensembl: ENSG00000204568
Vega: OTTHUMG00000031268
Pharos: Q9Y676(Tdark)
UniProt: Q9Y676 B0S7P4
LinkDB All DBs
Position
6p21.33
AA seq 258 aa AA seqDB search
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLE
SEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTS
HGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPP
RTPAEASSTGQTGPQSAL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctgtattaaacaccgtgctgaggcggcttcctatgctatctctcttccga
ggttctcacagagttcaggttcccctccagactctttgcaccaaagctccctctgaggaa
gattctttgtcctcagttcccatttctccttataaggatgagccctggaaatatctggaa
tcagaagaataccaggagcgatatggttctcgccccgtctgggctgactaccgccgcaac
cacaagggtggtgtacccccacagcggactcggaagacatgtattcgtcggaataaagtt
gttgggaatccctgccccatctgtcgagatcacaagttgcatgttgactttaggaacgtg
aagctcttggagcaatttgtctgcgcccacacgggtatcatcttctatgctccatacaca
ggagtctgtgtgaagcagcacaagcggttgacccaggccatccagaaagccagggatcat
ggtctcctcatttaccacatcccccaggttgaaccacgggaccttgacttcagtacctct
catggggctgtgagtgctactccgccagcccccaccctggtctcaggtgacccctggtac
ccatggtacaactggaaacagccaccggagagagaactgtctcgccttcgccggctttac
cagggtcatctccaagaagagagtggccccccacctgagtcaatgcccaagatgccccct
agaacaccagcggaagcctcctccactgggcagacaggccctcagagtgctctgtag

DBGET integrated database retrieval system