KEGG   Homo sapiens (human): 2909Help
Entry
2909              CDS       T01001                                 

Gene name
ARHGAP35, GRF-1, GRLF1, P190-A, P190A, p190ARhoGAP, p190RhoGAP
Definition
(RefSeq) Rho GTPase activating protein 35
  KO
K05732  glucocorticoid receptor DNA-binding factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
Network
nt06135  Cytoskeletal regulation (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2909 (ARHGAP35)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2909 (ARHGAP35)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2909 (ARHGAP35)
   04670 Leukocyte transendothelial migration
    2909 (ARHGAP35)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2909 (ARHGAP35)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    2909 (ARHGAP35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP RhoGAP-FF1 Ras FF NOG1 Cdh1_DBD_1 Thioredoxin_13 Hira
Motif
Other DBs
NCBI-GeneID: 2909
NCBI-ProteinID: NP_004482
OMIM: 605277
HGNC: 4591
Ensembl: ENSG00000160007
Vega: OTTHUMG00000183438
Pharos: Q9NRY4(Tbio)
UniProt: Q9NRY4
LinkDB All DBs
Structure
PDB: 

Position
19q13.32
AA seq 1499 aa AA seqDB search
MMMARKQDVRIPTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEFHLDHTSVLST
SDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHIVEQTEFIDDQTFQPHRSTALQPYIKRA
AATKLASAEKLMYFCTDQLGLEQDFEQKQMPDGKLLVDGFLLGIDVSRGMNRNFDDQLKF
VSNLYNQLAKTKKPIVVVLTKCDEGVERYIRDAHTFALSKKNLQVVETSARSNVNVDLAF
STLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKNHNENWLSVSRKMQ
ASPEYQDYVYLEGTQKAKKLFLQHIHRLKHEHIERRRKLYLAALPLAFEALIPNLDEIDH
LSCIKAKKLLETKPEFLKWFVVLEETPWDATSHIDNMENERIPFDLMDTVPAEQLYEAHL
EKLRNERKRVEMRRAFKENLETSPFITPGKPWEEARSFIMNEDFYQWLEESVYMDIYGKH
QKQIIDKAKEEFQELLLEYSELFYELELDAKPSKEKMGVIQDVLGEEQRFKALQKLQAER
DALILKHIHFVYHPTKETCPSCPACVDAKIEHLISSRFIRPSDRNQKNSLSDPNIDRINL
VILGKDGLARELANEIRALCTNDDKYVIDGKMYELSLRPIEGNVRLPVNSFQTPTFQPHG
CLCLYNSKESLSYVVESIEKSRESTLGRRDNHLVHLPLTLILVNKRGDTSGETLHSLIQQ
GQQIASKLQCVFLDPASAGIGYGRNINEKQISQVLKGLLDSKRNLNLVSSTASIKDLADV
DLRIVMCLMCGDPFSADDILFPVLQSQTCKSSHCGSNNSVLLELPIGLHKKRIELSVLSY
HSSFSIRKSRLVHGYIVFYSAKRKASLAMLRAFLCEVQDIIPIQLVALTDGAVDVLDNDL
SREQLTEGEEIAQEIDGRFTSIPCSQPQHKLEIFHPFFKDVVEKKNIIEATHMYDNAAEA
CSTTEEVFNSPRAGSPLCNSNLQDSEEDIEPSYSLFREDTSLPSLSKDHSKLSMELEGND
GLSFIMSNFESKLNNKVPPPVKPKPPVHFEITKGDLSYLDQGHRDGQRKSVSSSPWLPQD
GFDPSDYAEPMDAVVKPRNEEENIYSVPHDSTQGKIITIRNINKAQSNGSGNGSDSEMDT
SSLERGRKVSIVSKPVLYRTRCTRLGRFASYRTSFSVGSDDELGPIRKKEEDQASQGYKG
DNAVIPYETDEDPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFGVPLTTVVTPEKP
IPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGA
MKSFFSELPDPLVPYNMQIDLVEAHKINDREQKLHALKEVLKKFPKENHEVFKYVISHLN
KVSHNNKVNLMTSENLSICFWPTLMRPDFSTMDALTATRTYQTIIELFIQQCPFFFYNRP
ITEPPGARPSSPSAVASTVPFLTSTPVTSQPSPPQSPPPTPQSPMQPLLPSQLQAEHTL
NT seq 4500 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggcaagaaagcaagatgtccgaattcccacctacaacatcagtgtggtggga
ttatctgggaccgagaaggaaaagggccagtgtgggattggaaagtcttgtttgtgcaac
cgcttcgtgcgcccgagtgctgacgagtttcacttggaccatacctccgtcctcagcacc
agtgactttggagggcgagtggtcaataatgaccactttctctactggggagaagttagc
cgctccctggaggattgtgtggaatgtaagatgcacattgtggagcagactgaatttatt
gatgatcagacttttcaacctcatcgaagcacggccctgcagccctatatcaagagagct
gctgcgaccaagcttgcatcagctgaaaaactcatgtacttttgcactgaccagctgggg
ctggagcaggactttgagcagaaacaaatgccagacggaaagctgctggttgatggtttt
cttcttggtattgatgttagcaggggcatgaataggaactttgatgaccagctcaagttt
gtctccaatctctacaatcagcttgcaaaaacaaaaaagcccatagtggtggtcctgact
aagtgtgacgaaggtgttgagcggtacattagagatgcacatacttttgccttaagcaaa
aagaacctccaggttgtggagacctcagcgagatccaatgtaaacgtggacttggctttc
agcaccttagtgcaactcattgataaaagtcggggaaagacaaaaatcattccttatttt
gaagctctcaagcagcagagtcagcagatagctacagcaaaagacaagtatgagtggctg
gtgagtcgcattgtgaaaaaccacaatgagaactggctgagtgtcagccgaaagatgcag
gcctctccagaataccaggactatgtctacctggaagggactcagaaagccaagaagctg
tttctacagcacatccaccgcctcaagcatgagcatatcgagcgtaggagaaagctgtac
ctggcagccctgccattagcttttgaagctcttatacctaatctagatgaaatagaccac
ctaagctgcataaaagccaaaaagctcttagaaaccaagccagaattcttgaagtggttt
gttgtgcttgaagagaccccatgggatgccaccagtcacattgacaacatggaaaacgaa
cggattccctttgatttaatggataccgtccctgcagagcagctatacgaggcccactta
gagaagctgaggaacgaaaggaaaagagttgagatgcgaagggcgtttaaagaaaacctg
gagacttctcctttcataactcccggaaagccttgggaagaggcccgtagttttattatg
aatgaggatttctaccagtggctggaggaatctgtatacatggatatttatggcaaacac
caaaagcaaattatagataaagcaaaggaagaatttcaggagttgcttttggaatattca
gaattgttttatgaactggagctggatgctaagcccagcaaggagaagatgggtgttatt
caggatgttctgggagaggaacagcgatttaaagcattacaaaagctccaagcagagcgt
gatgcccttattctgaaacacattcattttgtgtaccacccaacaaaggagacatgcccc
agctgcccagcttgtgtggacgctaagattgagcacttgattagttctcggtttatccgg
ccgtctgaccggaatcagaaaaattcactctctgaccctaacattgatagaatcaacttg
gttatattgggcaaagacggccttgcccgagagttggccaatgagattcgagctctttgt
acaaatgatgacaagtatgtgatagatggtaaaatgtatgagctttccctgaggccaata
gaggggaatgtcaggcttcctgtgaactctttccagacgccaacatttcagccccacggc
tgtctctgcctttacaattcaaaggaatcgctatcctatgtagtggaaagtatagagaag
agtagagagtccacgctgggccggcgggataatcatttagtccatctcccccttacatta
attttggttaacaagagaggagacaccagtggagagactctgcatagcttaatacagcaa
ggtcaacaaattgctagcaaacttcagtgtgtctttctcgaccctgcttctgctggcatt
ggttacggacgcaacattaatgaaaagcaaatcagtcaagttttgaagggactcctggac
tctaagcgtaacttaaacctggtcagttctactgctagcatcaaagatttggctgatgtt
gatctgcgaattgttatgtgtctgatgtgtggagatccttttagtgcagatgacatactt
tttcctgtccttcagtcccaaacctgtaaatcttcccattgtggaagcaacaactctgtt
ttacttgaactaccaatcggactgcacaagaagcggattgaactgtctgttctttcatac
cattcctcctttagcatcagaaagagccggttggttcatgggtacattgttttttattca
gccaaacgtaaggcctctttggctatgttacgtgcctttctttgtgaagtgcaggatatt
atccctattcagcttgtagcactcactgatggcgctgtagatgtcctggacaatgactta
agtagggaacagctaactgagggggaggagattgctcaagaaattgacggaaggttcaca
agcatcccctgtagccaaccccagcataaacttgagatctttcacccattttttaaagat
gtggtggaaaaaaagaacataatcgaggctactcatatgtacgataatgctgccgaggcc
tgtagcaccaccgaagaggtgtttaactccccccgggcaggatcaccgctctgcaactca
aacctgcaggattcagaagaagatatcgagccatcttacagcctgtttcgagaagacaca
tcactgccttctctgtccaaagaccattctaagctctctatggaactggagggaaatgat
gggctgtctttcattatgagcaattttgagagtaaactgaacaacaaagtacctccgcca
gtcaaaccaaagcctcctgtccattttgaaattacaaagggggatctatcttatttagac
caaggccatagggatggacagaggaagtctgtgtcttctagcccctggctgcctcaggat
gggtttgatccttctgactatgctgaacccatggatgctgtggtgaagccaaggaatgaa
gaagaaaacatatactccgtgccccatgacagcacccaaggcaaaatcatcaccattcgg
aatatcaacaaagcccagtccaacggcagcgggaatggttctgacagtgaaatggacacc
agctctctagagcgagggcgcaaggtttccatcgtgagcaagccagtgctgtacaggacg
agatgcacccggctggggcggtttgctagttaccggaccagcttcagcgtggggagtgat
gatgagctggggcccatccggaagaaagaggaggatcaggcatcccagggttataaaggg
gacaatgctgtcattccatacgaaacagacgaagacccgcggaggaggaatattcttcgc
agcctaaggaggaacactaagaaaccaaagcccaaaccccggccatccatcacaaaggca
acctgggagagtaactattttggggtgcccttaacaactgtcgtgactccagagaagccg
atccccatttttattgaaagatgtattgagtacattgaagccacaggactgagcacggaa
ggcatctaccgggtcagcgggaacaagtctgagatggagagtctgcagagacagtttgat
caagaccacaacctggacctggcagagaaagactttacggtgaataccgtggctggtgcc
atgaagagctttttctcagaactgcctgaccccctggtcccgtataacatgcagatcgac
ttggtggaagcacacaaaatcaacgaccgggagcagaagttgcatgcccttaaggaggta
ttaaagaaatttccaaaggaaaaccacgaagtcttcaagtatgtcatctctcacctaaac
aaggtcagccacaacaacaaggtgaatctcatgaccagcgagaacctctccatctgcttc
tggcccaccttgatgagacctgatttcagcactatggacgccctcacagccacgcgcacc
taccagacaatcattgaactctttatccagcagtgccccttcttcttctacaatcggccc
atcaccgagccccccggcgccaggcccagctccccctctgccgtggcttccaccgtcccc
ttcctcacttccacgcctgtcacaagtcagccgtcgcccccacagtcgcctccacccacc
ccccagtccccaatgcagccactgcttccctcccagcttcaagccgaacacacgctgtga

KEGG   Homo sapiens (human): 394Help
Entry
394               CDS       T01001                                 

Gene name
ARHGAP5, GFI2, RhoGAP5, p190-B, p190BRhoGAP
Definition
(RefSeq) Rho GTPase activating protein 5
  KO
K13709  Rho GTPase-activating protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    394 (ARHGAP5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    394 (ARHGAP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    394 (ARHGAP5)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    394 (ARHGAP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP RhoGAP-FF1 Ras FF GTP_EFTU NOG1 Roc MMR_HSR1 U5_2-snRNA_bdg SR-25
Motif
Other DBs
NCBI-GeneID: 394
NCBI-ProteinID: NP_001025226
OMIM: 602680
HGNC: 675
Ensembl: ENSG00000100852
Vega: OTTHUMG00000170589
Pharos: Q13017(Tbio)
UniProt: Q13017
LinkDB All DBs
Structure
PDB: 

Position
14q12
AA seq 1502 aa AA seqDB search
MMAKNKEPRPPSYTISIVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDIIQNSEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFV
NNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFT
ALVQMLDKTRSKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLLPNLEEIEHLN
WSEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQH
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAYKYITEADSKEVYGRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCTDIKVEQLLASSLLQLDHGRLRLYHDSTNIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYFLSQLWTAAFKPHGCFC
VFNSIESLSFIGEFIGKIRTEASQIRKDKYMANLPFTLILANQRDSISKNLPILRHQGQQ
LANKLQCPFVDVPAGTYPRKFNETQIKQALRGVLESVKHNLDVVSPIPANKDLSEADLRI
VMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQ
SEDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYP
IHSTPNCHDHERNHKVPPPIKPKPVVPKTNVKKLDPNLLKTIEAGIGKNPRKQTSRVPLA
HPEDMDPSDNYAEPIDTIFKQKGYSDEIYVVPDDSQNRIKIRNSFVNNTQGDEENGFSDR
TSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDPL
LSPVETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKQKKKTKNFNPPTRRNWESNYF
GMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNINL
VSMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIVKKFHPV
NYDVFRYVITHLNRVSQQHKINLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVET
FIQQCQFFFYNGEIVETTNIVAPPPPSNPGQLVEPMVPLQLPPPLQPQLIQPQLQTDPLG
II
NT seq 4509 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaaaacaaagagcctcgtcccccatcctataccatcagtatagttggactc
tctgggactgaaaaagacaaaggtaactgtggagttggaaagtcttgtttgtgcaataga
tttgtacgctcaaaagcagatgaatattatccagagcatacttctgtgcttagcaccatt
gactttggaggacgagtagtaaacaatgatcactttttgtactggggtgacataatacaa
aatagtgaagatggagtagaatgcaaaattcatgtcattgaacaaacagagttcattgat
gaccagactttcttgcctcatcggagtacgaatttgcaaccatatataaaacgtgcagct
gcatctaaattgcagtcagcagaaaaactaatgtacatttgcactgatcagctaggctta
gaacaagactttgaacagaagcaaatgcctgaagggaagctcaacgtagatggattttta
ttatgcattgatgtaagtcaaggatgcaataggaagtttgatgatcaacttaaatttgtg
aataacctttttgtccagttatcaaaatcaaaaaaacctgtaataatagcagcaactaaa
tgtgatgaatgcgtggatcattatcttagagaagttcaggcatttgcttcaaataaaaag
aaccttcttgtagtggaaacatcagcacgatttaatgtcaacattgaaacatgttttact
gcactggtacaaatgttggataaaactcgtagcaagcctaaaattattccctatttggat
gcttataaaacacagagacaacttgttgtcacagcaacagataagtttgaaaaacttgtg
cagactgtgagagattatcatgcaacttggaaaactgttagtaataaattaaaaaatcat
cctgattatgaagaatacatcaacttagagggaacaagaaaggccagaaatacattctca
aaacatatagaacaacttaaacaggaacatataagaaaaaggagagaagagtatataaat
actttaccaagagcttttaacactcttttgccaaatctagaagagattgaacatttgaat
tggtcagaagctttgaagttaatggaaaagagagcagatttccagttatgttttgtggtg
ctagaaaaaactccttgggatgaaactgaccatatagacaaaattaatgataggcggatt
ccatttgacctcctgagcactttagaagctgaaaaagtctatcagaaccatgtacagcat
ctgatatccgagaagaggagggtggaaatgaaggaaaaattcaaaaagactttggaaaaa
attcaattcatttcaccagggcagccatgggaggaagttatgtgctttgttatggaggat
gaagcctacaaatatatcactgaggctgatagcaaagaggtatatggtaggcatcagcga
gaaatagttgaaaaagccaaagaagagtttcaagaaatgctttttgagcattctgaactt
ttttatgatttagatcttaatgcaacacctagttcagataaaatgagtgaaattcataca
gttctgagtgaagaacctagatataaagctttacagaaacttgcacctgatagggaatcc
cttctacttaagcatataggatttgtttatcatcccactaaagaaacatgtcttagtggc
caaaattgtacagacattaaagtggagcagttacttgctagtagtcttttacagttggat
catggccgcttaagattatatcacgatagtaccaatatagataaagttaacctttttatt
ttagggaaggatggccttgcccaagaactagcaaatgagataaggacacaatccactgat
gatgagtatgccttagatggaaaaatttatgaacttgatcttcggccggttgatgccaaa
tcgccttactttttgagtcagttatggactgccgcctttaaaccacatgggtgcttctgt
gtatttaattccattgagtcattgagttttattggggaatttattgggaaaataagaact
gaagcttctcagatcagaaaagataaatacatggctaatcttccatttacattaattctg
gctaatcagagagattccattagtaagaatctaccaattctcaggcaccaagggcagcag
ttggcaaacaagttgcaatgtccttttgtagatgtacctgctggtacatatcctcgtaaa
tttaatgaaacccaaataaagcaagctctcagaggagtattggaatcagttaaacacaat
ttggatgtggtgagcccaattcctgccaataaggacttatcagaagctgacttgagaatt
gtcatgtgcgccatgtgtggagatccatttagtgtggatcttattctttcacccttcctt
gattctcattcttgcagtgctgctcaagctggacagaataattccctaatgcttgataaa
atcattggtgaaaaaaggaggcgaatacagatcacaatattatcataccactcttcaatt
ggagtaagaaaagatgaactagttcatgggtatatattagtttactctgcaaaacggaaa
gcttcgatgggaatgcttcgagcatttctatcagaagttcaagacaccattcctgtacag
ctggtggcagttactgacagccaagcagatttttttgaaaatgaggctatcaaagagtta
atgactgaaggagaacacattgcaactgagatcactgctaaatttacagcactgtattct
ttatctcagtatcatcggcaaactgaggtctttactctgttttttagtgatgttctagag
aaaaaaaatatgatagaaaattcttatttgtctgataatacaagggaatcaacccatcaa
agtgaagatgtttttctaccatctcccagagactgttttccctataataactaccctgat
tcagatgatgacacagaagcaccacctccttatagtccaattggggatgatgtacagttg
cttccaacacctagtgaccgttccagatatagattagatttggaaggaaatgagtatcct
attcatagtaccccaaactgtcatgaccatgaacgcaaccataaagtgcctccacctatt
aaacctaaaccagttgtacctaagacaaatgtgaaaaaactcgatccaaaccttttaaaa
acaattgaagctggtattggtaaaaatccaagaaagcagacttcccgggtgcctttggca
catcctgaagatatggatccttcagataactatgcggaacccattgatacaattttcaaa
cagaagggctattctgatgagatttatgttgtcccagatgatagtcaaaatcgtattaaa
attcgaaactcatttgtaaataacacccaaggagatgaagaaaatgggttttctgataga
acctcaaaaagtcatggggaacggaggccttcaaaatacaaatataaatctaaaaccttg
tttagtaaagccaagtcatactatagaagaacacattcagatgccagtgatgatgaggct
ttcaccacttctaaaacaaaaagaaaaggaagacatcgtggaagtgaagaagatccactt
ctttctcctgttgaaacttggaaaggtggtattgataatcctgcaatcacttctgaccag
gagttagatgataagaagatgaagaagaaaacccacaaagtgaaagaagataaaaagcag
aaaaagaaaactaagaacttcaatccaccaacacgtagaaattgggaaagtaattacttt
gggatgcccctccaggatctggttacagctgagaagcccataccactatttgttgagaaa
tgtgtggaatttattgaagatacagggttatgtaccgaaggactctaccgtgtcagcggg
aataaaactgaccaagacaatattcaaaagcagtttgatcaagatcataatatcaatcta
gtgtcaatggaagtaacagtaaatgctgtagctggagcccttaaagctttctttgcagat
ctgccagatcctttaattccatattctcttcatccagaactattggaagcagcaaaaatc
ccggataaaacagaacgtcttcatgccttgaaagaaattgttaagaaatttcatcctgta
aactatgatgtattcagatacgtgataacacatctaaacagggttagtcagcaacataaa
atcaacctaatgacagcagacaacttatccatctgtttttggccaaccttgatgagacct
gattttgaaaatcgagagtttctgtctactactaagattcatcaatctgttgttgaaaca
ttcattcagcagtgtcagtttttcttttacaatggagaaattgtagaaacgacaaacatt
gtggctcctccaccaccttcaaacccaggacagttggtggaaccaatggtgccacttcag
ttgccgccaccattgcaacctcagctgatacaaccacaattacaaacggatcctcttggt
attatatga

DBGET integrated database retrieval system