KEGG   Homo sapiens (human): 29107
Entry
29107             CDS       T01001                                 

Gene name
NXT1, MTR2, P15
Definition
(RefSeq) nuclear transport factor 2 like export factor 1
  KO
K14285  NTF2-related export protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05164  Influenza A
Network
nt06170  Influenza A virus (IAV)
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N00746  IAV NS1 to nuclear export of mRNA
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    29107 (NXT1)
   03015 mRNA surveillance pathway
    29107 (NXT1)
   03008 Ribosome biogenesis in eukaryotes
    29107 (NXT1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    29107 (NXT1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29107 (NXT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    29107 (NXT1)
   03009 Ribosome biogenesis [BR:hsa03009]
    29107 (NXT1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     29107 (NXT1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    29107 (NXT1)
SSDB
Motif
Pfam: NTF2 Cofilin_ADF
Other DBs
NCBI-GeneID: 29107
NCBI-ProteinID: NP_037380
OMIM: 605811
HGNC: 15913
Ensembl: ENSG00000132661
Vega: OTTHUMG00000032059
Pharos: Q9UKK6(Tbio)
UniProt: Q9UKK6
LinkDB
Structure
PDB: 
1JKG 1JN5 4WYK 6E5U

Position
20p11.21
AA seq 140 aa
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE
FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQAS
PSNTVWKIASDCFRFQDWAS
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcatctgtggatttcaagacctatgtggatcaggcctgcagagctgctgaggagttt
gtcaatgtctactacaccaccatggataagcggcggcgtttgctgtcccgcctgtacatg
ggcacagccaccctggtctggaatggcaatgctgtttcaggacaagaatccttgagtgag
ttttttgaaatgttgccttccagcgagttccaaatcagcgtggtagactgccagcctgtt
catgatgaagccacaccaagccagaccacggtccttgttgtcatctgtggatcagtgaag
tttgaggggaacaaacaacgggacttcaaccagaacttcatcctgaccgcccaggcctca
cccagcaacacagtgtggaagatcgcaagtgactgcttccgcttccaggactgggccagc
tag

DBGET integrated database retrieval system