KEGG   Homo sapiens (human): 29107
Entry
29107             CDS       T01001                                 

Gene name
NXT1, MTR2, P15
Definition
(RefSeq) nuclear transport factor 2 like export factor 1
  KO
K14285  NTF2-related export protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05164  Influenza A
Network
nt06170  Influenza A virus (IAV)
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N00746  IAV NS1 to nuclear export of mRNA
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    29107 (NXT1)
   03015 mRNA surveillance pathway
    29107 (NXT1)
   03008 Ribosome biogenesis in eukaryotes
    29107 (NXT1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29107 (NXT1)
  09172 Infectious disease: viral
   05164 Influenza A
    29107 (NXT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    29107 (NXT1)
   03009 Ribosome biogenesis [BR:hsa03009]
    29107 (NXT1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     29107 (NXT1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    29107 (NXT1)
SSDB
Motif
Pfam: NTF2 Cofilin_ADF
Other DBs
NCBI-GeneID: 29107
NCBI-ProteinID: NP_037380
OMIM: 605811
HGNC: 15913
Ensembl: ENSG00000132661
Vega: OTTHUMG00000032059
Pharos: Q9UKK6(Tbio)
UniProt: Q9UKK6
LinkDB
Structure
PDB: 
1JKG 1JN5 4WYK 6E5U

Position
20p11.21
AA seq 140 aa
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE
FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQAS
PSNTVWKIASDCFRFQDWAS
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcatctgtggatttcaagacctatgtggatcaggcctgcagagctgctgaggagttt
gtcaatgtctactacaccaccatggataagcggcggcgtttgctgtcccgcctgtacatg
ggcacagccaccctggtctggaatggcaatgctgtttcaggacaagaatccttgagtgag
ttttttgaaatgttgccttccagcgagttccaaatcagcgtggtagactgccagcctgtt
catgatgaagccacaccaagccagaccacggtccttgttgtcatctgtggatcagtgaag
tttgaggggaacaaacaacgggacttcaaccagaacttcatcctgaccgcccaggcctca
cccagcaacacagtgtggaagatcgcaagtgactgcttccgcttccaggactgggccagc
tag

KEGG   Homo sapiens (human): 55916
Entry
55916             CDS       T01001                                 

Gene name
NXT2, P15-2
Definition
(RefSeq) nuclear transport factor 2 like export factor 2
  KO
K14285  NTF2-related export protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05164  Influenza A
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    55916 (NXT2)
   03015 mRNA surveillance pathway
    55916 (NXT2)
   03008 Ribosome biogenesis in eukaryotes
    55916 (NXT2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    55916 (NXT2)
  09172 Infectious disease: viral
   05164 Influenza A
    55916 (NXT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    55916 (NXT2)
   03009 Ribosome biogenesis [BR:hsa03009]
    55916 (NXT2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     55916 (NXT2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    55916 (NXT2)
SSDB
Motif
Pfam: NTF2
Other DBs
NCBI-GeneID: 55916
NCBI-ProteinID: NP_001229546
OMIM: 300320
HGNC: 18151
Ensembl: ENSG00000101888
Vega: OTTHUMG00000022185
Pharos: Q9NPJ8(Tdark)
UniProt: Q9NPJ8
LinkDB
Position
Xq23
AA seq 142 aa
MATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALN
NFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQS
TPNNTVWKIASDCFRFQDWSSS
NT seq 429 nt   +upstreamnt  +downstreamnt
atggccacgtctctggattttaaaacttatgtagatcaggcatgtagagctgctgaggag
tttgtcaatatttactatgagacaatggataaaagaagacgggcactaaccaggctgtat
ctggacaaggccaccttaatatggaatggaaatgctgtttcagggctggatgccctaaat
aatttttttgacacattgccttctagtgagttccaggtcaatatgttagattgccaacca
gttcatgagcaagcaactcagtcccaaactacagttcttgttgtgaccagtggaactgtg
aagtttgatggaaacaaacaacatttcttcaaccagaacttcctgctgactgctcagtcc
actcccaacaatactgtgtggaagattgcaagtgattgcttccgttttcaagattggtct
agtagttaa

DBGET integrated database retrieval system