KEGG   Homo sapiens (human): 2911
Entry
2911              CDS       T01001                                 

Gene name
GRM1, GPRC1A, MGLU1, MGLUR1, PPP1R85, SCA44, SCAR13
Definition
(RefSeq) glutamate metabotropic receptor 1
  KO
K04603  metabotropic glutamate receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04068  FoxO signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04730  Long-term depression
hsa04742  Taste transduction
hsa04915  Estrogen signaling pathway
hsa05017  Spinocerebellar ataxia
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06410  Calcium signaling
nt06440  Transcription
nt06462  Spinocerebellar ataxia
nt06463  Parkinson disease
  Element
N00953  mGluR1-TRPC3 signaling pathway
N00954  Mutation-activated GRM1 to mGluR1-TRPC3 signaling pathway
N00955  Mutation-inactivated PRKCG to mGluR1-TRPC3 signaling pathway
N00956  Mutation-activated PRKCG to mGluR1-TRPC3 signaling pathway
N00957  Mutation-caused abberant ATXN2/3 to mGluR5-Ca2+ -apoptotic pathway
N00958  Mutation-activated ITPR1 to mGluR1-TRPC3 signaling pathway
N00959  ITPR1-reduced expression to mGluR1-TRPC3 signaling pathway
N00960  Mutation-caused aberrant SPTBN2 to mGluR1-TRPC3 signaling pathway
N00965  RORA-mediated transcription
N00966  Mutation-caused aberrant ATXN1 to RORA-mediated transcription
Disease
H00063  Spinocerebellar ataxia (SCA)
H01891  Autosomal recessive spinocerebellar ataxias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    2911 (GRM1)
   04020 Calcium signaling pathway
    2911 (GRM1)
   04072 Phospholipase D signaling pathway
    2911 (GRM1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2911 (GRM1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    2911 (GRM1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    2911 (GRM1)
  09156 Nervous system
   04724 Glutamatergic synapse
    2911 (GRM1)
   04720 Long-term potentiation
    2911 (GRM1)
   04730 Long-term depression
    2911 (GRM1)
   04723 Retrograde endocannabinoid signaling
    2911 (GRM1)
  09157 Sensory system
   04742 Taste transduction
    2911 (GRM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    2911 (GRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    2911 (GRM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    2911 (GRM1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2911 (GRM1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     2911 (GRM1)
G protein-coupled receptors [BR:hsa04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   2911 (GRM1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G DUF5438 DUF2318 AAA_34
Other DBs
NCBI-GeneID: 2911
NCBI-ProteinID: NP_001264993
OMIM: 604473
HGNC: 4593
Ensembl: ENSG00000152822
Vega: OTTHUMG00000015752
Pharos: Q13255(Tchem)
UniProt: Q13255 Q59HC2
LinkDB
Structure
PDB: 
3KS9

Position
6q24.3
AA seq 1194 aa
MVGLLLFFFPAIFLEVSLLPRSPGRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
EFIRDSLISIRDEKDGINRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEENYVQDSKMGFVINAIYAM
AHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYD
IMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGVVRSVCSEPCLKGQIKVIRKGE
VSCCWICTACKENEYVQDEFTCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFS
CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQ
RLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTL
VVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPAN
FNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKAGAGNANSNGKSVSWSEPGG
GQVPKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEE
EDAQPIRFSPPGSPSMVVHRRVPSAATTPPLPSHLTAEETPLFLAEPALPKGLPPPLQQQ
QQPPPQQKSLMDQLQGVVSNFSTAIPDFHAVLAGPGGPGNGLRSLYPPPPPPQHLQMLPL
QLSTFGEELVSPPADDDDDSERFKLLQEYVYEHEREGNTEEDELEEEEEDLQAASKLTPD
DSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVSYASVILRDYKQSSSTL
NT seq 3585 nt   +upstreamnt  +downstreamnt
atggtcgggctccttttgttttttttcccagcgatctttttggaggtgtcccttctcccc
agaagccccggcaggaaagtgttgctggcaggagcgtcgtctcagcgctcggtggccaga
atggacggagatgtcatcattggagccctcttctcagtccatcaccagcctccggccgag
aaagtgcccgagaggaagtgtggggagatcagggagcagtatggcatccagagggtggag
gccatgttccacacgttggataagatcaacgcggacccggtcctcctgcccaacatcacc
ctgggcagtgagatccgggactcctgctggcactcttccgtggctctggaacagagcatt
gagttcattagggactctctgatttccattcgagatgagaaggatgggatcaaccggtgt
ctgcctgacggccagtccctccccccaggcaggactaagaagcccattgcgggagtgatc
ggtcccggctccagctctgtagccattcaagtgcagaacctgctccagctcttcgacatc
ccccagatcgcttattcagccacaagcatcgacctgagtgacaaaactttgtacaaatac
ttcctgagggttgtcccttctgacactttgcaggcaagggccatgcttgacatagtcaaa
cgttacaattggacctatgtctctgcagtccacacggaagggaattatggggagagcgga
atggacgctttcaaagagctggctgcccaggaaggcctctgtatcgcccattctgacaaa
atctacagcaacgctggggagaagagctttgaccgactcttgcgcaaactccgagagagg
cttcccaaggctagagtggtggtctgcttctgtgaaggcatgacagtgcgaggactcctg
agcgccatgcggcgccttggcgtcgtgggcgagttctcactcattggaagtgatggatgg
gcagacagagatgaagtcattgaaggttatgaggtggaagccaacgggggaatcacgata
aagctgcagtctccagaggtcaggtcatttgatgattatttcctgaaactgaggctggac
actaacacgaggaatccctggttccctgagttctggcaacatcggttccagtgccgcctt
ccaggacaccttctggaaaatcccaactttaaacgaatctgcacaggcaatgaaagctta
gaagaaaactatgtccaggacagtaagatggggtttgtcatcaatgccatctatgccatg
gcacatgggctgcagaacatgcaccatgccctctgccctggccacgtgggcctctgcgat
gccatgaagcccatcgacggcagcaagctgctggacttcctcatcaagtcctcattcatt
ggagtatctggagaggaggtgtggtttgatgagaaaggagacgctcctggaaggtatgat
atcatgaatctgcagtacactgaagctaatcgctatgactatgtgcacgttggaacctgg
catgaaggagtgctgaacattgatgattacaaaatccagatgaacaagagtggagtggtg
cggtctgtgtgcagtgagccttgcttaaagggccagattaaggttatacggaaaggagaa
gtgagctgctgctggatttgcacggcctgcaaagagaatgaatatgtgcaagatgagttc
acctgcaaagcttgtgacttgggatggtggcccaatgcagatctaacaggctgtgagccc
attcctgtgcgctatcttgagtggagcaacatcgaatccattatagccatcgccttttca
tgcctgggaatccttgttaccttgtttgtcaccctaatctttgtactgtaccgggacaca
ccagtggtcaaatcctccagtcgggagctctgctacatcatcctagctggcatcttcctt
ggttatgtgtgcccattcactctcattgccaaacctactaccacctcctgctacctccag
cgcctcttggttggcctctcctctgcgatgtgctactctgctttagtgactaaaaccaat
cgtattgcacgcatcctggctggcagcaagaagaagatctgcacccggaagcccaggttc
atgagtgcctgggctcaggtgatcattgcctcaattctgattagtgtgcaactaaccctg
gtggtaaccctgatcatcatggaaccccctatgcccattctgtcctacccaagtatcaag
gaagtctaccttatctgcaataccagcaacctgggtgtggtggcccctttgggctacaat
ggactcctcatcatgagctgtacctactatgccttcaagacccgcaacgtgcccgccaac
ttcaacgaggccaaatatatcgcgttcaccatgtacaccacctgtatcatctggctagct
tttgtgcccatttactttgggagcaactacaagatcatcacaacttgctttgcagtgagt
ctcagtgtaacagtggctctggggtgcatgttcactcccaagatgtacatcattattgcc
aagcctgagaggaatgtccgcagtgccttcaccacctctgatgttgtccgcatgcatgtt
ggcgatggcaagctgccctgccgctccaacactttcctcaacatcttccgaagaaagaag
gcaggggcagggaatgccaattctaatggcaagtctgtgtcatggtctgaaccaggtgga
ggacaggtgcccaagggacagcatatgtggcaccgcctctctgtgcacgtgaagaccaat
gagacggcctgcaaccaaacagccgtcatcaagcccctcactaaaagttaccaaggctct
ggcaagagcctgaccttttcagataccagcaccaagaccctttacaacgtagaggaggag
gaggatgcccagccgattcgctttagcccgcctggtagcccttccatggtggtgcacagg
cgcgtgccaagcgcggcgaccactccgcctctgccgtcccacctgaccgcagaggagacc
cccctcttcctggccgaaccagccctccccaagggcttgccccctcctctccagcagcag
cagcaaccccctccacagcagaaatcgctgatggaccagctccagggagtggtcagcaac
ttcagtaccgcgatcccggattttcacgcggtgctggcaggccccggtggtcccgggaac
gggctgcggtccctgtacccgcccccgccacctccgcagcacctgcagatgctgccgctg
cagctgagcacctttggggaggagctggtctccccgcccgcggacgacgacgacgacagc
gagaggtttaagctcctccaggagtacgtgtatgagcacgagcgggaagggaacacggaa
gaagacgaactggaagaggaggaggaggacctgcaggcggccagcaaactgaccccggat
gattcgcctgcgctgacgcctccgtcgcctttccgcgactcggtggcctcgggcagctcg
gtgcccagctcccccgtgtccgagtcggtgctctgcacccctcccaacgtatcctacgcc
tctgtcattctgcgggactacaagcaaagctcttccaccctgtaa

KEGG   Homo sapiens (human): 2915
Entry
2915              CDS       T01001                                 

Gene name
GRM5, GPRC1E, MGLUR5, PPP1R86, mGlu5
Definition
(RefSeq) glutamate metabotropic receptor 5
  KO
K04604  metabotropic glutamate receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa05010  Alzheimer disease
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06410  Calcium signaling
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N00984  mGluR5-Ca2+ -apoptotic pathway
N00985  Mutation-caused aberrant Htt to mGluR5-Ca2+ -apoptotic pathway
N01002  Mutation-caused aberrant Abeta to mGluR5-Ca2+ -apoptotic pathway
Drug target
Fenobam: D04155
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    2915 (GRM5)
   04072 Phospholipase D signaling pathway
    2915 (GRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2915 (GRM5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    2915 (GRM5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2915 (GRM5)
   04720 Long-term potentiation
    2915 (GRM5)
   04723 Retrograde endocannabinoid signaling
    2915 (GRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    2915 (GRM5)
   05016 Huntington disease
    2915 (GRM5)
   05022 Pathways of neurodegeneration - multiple diseases
    2915 (GRM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2915 (GRM5)
G protein-coupled receptors [BR:hsa04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   2915 (GRM5)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G DUF5438
Other DBs
NCBI-GeneID: 2915
NCBI-ProteinID: NP_001137303
OMIM: 604102
HGNC: 4597
Ensembl: ENSG00000168959
Vega: OTTHUMG00000134306
Pharos: P41594(Tchem)
UniProt: P41594
LinkDB
Structure
PDB: 

Position
11q14.2-q14.3
AA seq 1212 aa
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS
DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI
CIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQ
HRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFD
YINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN
EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVV
FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS
ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM
HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT
TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMG
NGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRG
LGAGAGAGGSAGGVGATGGAGCAGAGPGGPESPDAGPKALYDVAEAEEHFPAPARPRSPS
PISTLSHRAGSASRTDDDVPSLHSEPVARSSSSQGSLMEQISSVVTRFTANISELNSMML
STAAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAAGDAA
RESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTL
IIRDYTQSSSSL
NT seq 3639 nt   +upstreamnt  +downstreamnt
atggtccttctgttgatcctgtcagtcttacttttgaaagaagatgtccgtgggagtgca
cagtccagtgagaggagggtggtggctcacatgccgggtgacatcattattggagctctc
ttttctgttcatcaccagcctactgtggacaaagttcatgagaggaagtgtggggcggtc
cgtgaacagtatggcattcagagagtggaggccatgctgcataccctggaaaggatcaat
tcagaccccacactcttgcccaacatcacactgggctgtgagataagggactcctgctgg
cattcggctgtggccctagagcagagcattgagttcataagagattccctcatttcttca
gaagaggaagaaggcttggtacgctgtgtggatggctcctcctcttccttccgctccaag
aagcccatagtaggggtcattgggcctggctccagttctgtagccattcaggtccagaat
ttgctccagcttttcaacatacctcagattgcttactcagcaaccagcatggatctgagt
gacaagactctgttcaaatatttcatgagggttgtgccttcagatgctcagcaggcaagg
gccatggtggacatagtgaagaggtacaactggacctatgtatcagccgtgcacacagaa
ggcaactatggagaaagtgggatggaagccttcaaagatatgtcagcgaaggaagggatt
tgcatcgcccactcttacaaaatctacagtaatgcaggggagcagagctttgataagctg
ctgaagaagctcacaagtcacttgcccaaggcccgggtggtggcctgcttctgtgagggc
atgacggtgagaggtctgctgatggccatgaggcgcctgggtctagcgggagaatttctg
cttctgggcagtgatggctgggctgacaggtatgatgtgacagatggatatcagcgagaa
gctgttggtggcatcacaatcaagctccaatctcccgatgtcaagtggtttgatgattat
tatctgaagctccggccagaaacaaaccaccgaaacccttggtttcaagaattttggcag
catcgttttcagtgccgactggaagggtttccacaggagaacagcaaatacaacaagact
tgcaatagttctctgactctgaaaacacatcatgttcaggattccaaaatgggatttgtg
atcaacgccatctattcgatggcctatgggctccacaacatgcagatgtccctctgccca
ggctatgcaggactctgtgatgccatgaagccaattgatggacggaaacttttggagtcc
ctgatgaaaaccaattttactggggtttctggagatacgatcctattcgatgagaatgga
gactctccaggaaggtatgaaataatgaatttcaaggaaatgggaaaagattactttgat
tatatcaacgttggaagttgggacaatggagaattaaaaatggatgatgatgaagtatgg
tccaagaaaagcaacatcatcagatctgtgtgcagtgaaccatgtgagaaaggccagatc
aaggtgatccgaaagggagaagtcagctgttgttggacctgtacaccttgtaaggagaat
gagtatgtctttgatgagtacacatgcaaggcatgccaactggggtcttggcccactgat
gatctcacaggttgtgacttgatcccagtacagtatcttcgatggggtgaccctgaaccc
attgcagctgtggtgtttgcctgccttggcctcctggccaccctgtttgttactgtagtc
ttcatcatttaccgtgatacaccagtagtcaagtcctcaagcagggaactctgctacatt
atccttgctggcatctgcctgggctacttatgtaccttctgcctcattgcgaagcccaaa
cagatttactgctaccttcagagaattggcattggtctctccccagccatgagctactca
gcccttgtaacaaagaccaaccgtattgcaaggatcctggctggcagcaagaagaagatc
tgtaccaaaaagcccagattcatgagtgcctgtgcccagctagtgattgctttcattctc
atatgcatccagttgggcatcatcgttgccctctttataatggagcctcctgacataatg
catgactacccaagcattcgagaagtctacctgatctgtaacaccaccaacctaggagtt
gtcactccacttggatacaatggattgttgattttgagctgcaccttctatgcgttcaag
accagaaatgttccagctaacttcaacgaggccaagtatatcgccttcacaatgtacacg
acctgcattatatggctagcttttgtgccaatctactttggcagcaactacaaaatcatc
accatgtgtttctcggtcagcctcagtgccacagtggccctaggctgcatgtttgtgccg
aaggtgtacatcatcctggccaaaccagagagaaacgtgcgcagcgccttcaccacatct
accgtggtgcgcatgcatgtaggggatggcaagtcatcctccgcagccagcagatccagc
agcctagtcaacctgtggaagagaaggggctcctctggggaaaccttaaggtacaaagac
aggagactggcccagcacaagtcggaaatagagtgtttcacccccaaagggagtatgggg
aatggtgggagagcaacaatgagcagttccaatggaaaatccgtcacgtgggcccagaat
gagaagagcagccgggggcagcacctgtggcagcgcctgtccatccacatcaacaagaaa
gaaaaccccaaccaaacggccgtcatcaagcccttccccaagagcacggagagccgtggc
ctgggcgctggcgctggcgcaggcgggagcgctgggggcgtgggggccacgggcggtgcg
ggctgcgcaggcgccggcccaggcgggcccgagtccccagacgccggccccaaggcgctg
tatgatgtggccgaggctgaggagcacttcccggcgcccgcgcggccgcgctcaccgtcg
cccatcagcacgctgagccaccgcgcgggctcggccagccgcacggacgacgatgtgccg
tcgctgcactcggagcctgtggcgcgcagcagctcctcgcagggctccctcatggagcag
atcagcagtgtggtcacccgcttcacggccaacatcagcgagctcaactccatgatgctg
tccaccgcggcccccagccccggcgtcggcgccccgctctgctcgtcctacctgatcccc
aaagagatccagttgcccacgaccatgacgacctttgccgaaatccagcctctgccggcc
atcgaagtcacgggaggcgcgcagcccgcggcaggggcgcaggcggctggggacgcggcc
cgggagagccccgcggccggtcccgaggctgcggccgccaagccagacctggaggagctg
gtggctctcaccccgccgtcccccttcagagactcggtggactcggggagcacaaccccc
aactcgccagtgtccgagtcggccctctgtatcccgtcgtctcccaaatatgacactctt
atcataagagattacactcagagctcctcgtcgttgtga

DBGET integrated database retrieval system