KEGG   Homo sapiens (human): 29110Help
Entry
29110             CDS       T01001                                 

Gene name
TBK1, FTDALS4, IIAE8, NAK, T2K
Definition
(RefSeq) TANK binding kinase 1
  KO
K05410  TANK-binding kinase 1 [EC:2.7.11.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04137  Mitophagy - animal
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04657  IL-17 signaling pathway
hsa05135  Yersinia infection
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06121  TLR signaling (virus)
nt06133  RIG-I signaling (virus)
nt06134  CGAS-STING signaling (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00149  TLR3-IRF3 signaling pathway
N00268  HBV HBx to RIG-I-like receptor signaling pathway
N00271  HCV NS3/4A to RIG-I-like receptor signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00516  HCV NS3/4A to TLR3-IRF3 signaling pathway
N00552  HBV pol to TLR3-IRF3 signaling pathway
N00553  TLR4-IRF3/7 signaling pathway
N00554  HBV HBe to TLR4-IRF3/7 signaling pathway
N00555  HBV HBe to TLR4-IRF3/7 signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
N00685  MV V to RIG-I-IRF7/3 signaling pathway
N00727  IAV NS1 to RIG-I-like receptor signaling pathway
N00728  IAV NS1 to RIG-I-like receptor signaling pathway
N00732  IAV PB1-F2/PB2 to RIG-I-like receptor signaling pathway
N00734  IAV PB1-F2/PB2 to RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    29110 (TBK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    29110 (TBK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    29110 (TBK1)
   04621 NOD-like receptor signaling pathway
    29110 (TBK1)
   04622 RIG-I-like receptor signaling pathway
    29110 (TBK1)
   04623 Cytosolic DNA-sensing pathway
    29110 (TBK1)
   04657 IL-17 signaling pathway
    29110 (TBK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    29110 (TBK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    29110 (TBK1)
   05162 Measles
    29110 (TBK1)
   05164 Influenza A
    29110 (TBK1)
   05161 Hepatitis B
    29110 (TBK1)
   05160 Hepatitis C
    29110 (TBK1)
   05168 Herpes simplex virus 1 infection
    29110 (TBK1)
   05163 Human cytomegalovirus infection
    29110 (TBK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    29110 (TBK1)
   05169 Epstein-Barr virus infection
    29110 (TBK1)
   05165 Human papillomavirus infection
    29110 (TBK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    29110 (TBK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    29110 (TBK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     29110 (TBK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   29110 (TBK1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    29110 (TBK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD Pkinase_Tyr Pkinase_fungal Kinase-like DUF713 CEP63 Casc1_N
Motif
Other DBs
NCBI-GeneID: 29110
NCBI-ProteinID: NP_037386
OMIM: 604834
HGNC: 11584
Ensembl: ENSG00000183735
Vega: OTTHUMG00000168796
Pharos: Q9UHD2(Tchem)
UniProt: Q9UHD2
LinkDB All DBs
Structure
PDB: 

Position
12q14.2
AA seq 729 aa AA seqDB search
MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVV
GGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYL
HPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITG
KPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFA
ETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLV
LEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITG
VVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVK
VYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQE
GTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTH
FTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQ
KMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMD
GGLRNVDCL
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcacttctaatcatctgtggcttttatctgatattttaggccaaggagctact
gcaaatgtctttcgtggaagacataagaaaactggtgatttatttgctatcaaagtattt
aataacataagcttccttcgtccagtggatgttcaaatgagagaatttgaagtgttgaaa
aaactcaatcacaaaaatattgtcaaattatttgctattgaagaggagacaacaacaaga
cataaagtacttattatggaattttgtccatgtgggagtttatacactgttttagaagaa
ccttctaatgcctatggactaccagaatctgaattcttaattgttttgcgagatgtggtg
ggtggaatgaatcatctacgagagaatggtatagtgcaccgtgatatcaagccaggaaat
atcatgcgtgttataggggaagatggacagtctgtgtacaaactcacagattttggtgca
gctagagaattagaagatgatgagcagtttgtttctctgtatggcacagaagaatatttg
caccctgatatgtatgagagagcagtgctaagaaaagatcatcagaagaaatatggagca
acagttgatctttggagcattggggtaacattttaccatgcagctactggatcactgcca
tttagaccctttgaagggcctcgtaggaataaagaagtgatgtataaaataattacagga
aagccttctggtgcaatatctggagtacagaaagcagaaaatggaccaattgactggagt
ggagacatgcctgtttcttgcagtctttctcggggtcttcaggttctacttacccctgtt
cttgcaaacatccttgaagcagatcaggaaaagtgttggggttttgaccagttttttgca
gaaactagtgatatacttcaccgaatggtaattcatgttttttcgctacaacaaatgaca
gctcataagatttatattcatagctataatactgctactatatttcatgaactggtatat
aaacaaaccaaaattatttcttcaaatcaagaacttatctacgaagggcgacgcttagtc
ttagaacctggaaggctggcacaacatttccctaaaactactgaggaaaaccctatattt
gtagtaagccgggaacctctgaataccataggattaatatatgaaaaaatttccctccct
aaagtacatccacgttatgatttagacggggatgctagcatggctaaggcaataacaggg
gttgtgtgttatgcctgcagaattgccagtaccttactgctttatcaggaattaatgcga
aaggggatacgatggctgattgaattaattaaagatgattacaatgaaactgttcacaaa
aagacagaagttgtgatcacattggatttctgtatcagaaacattgaaaaaactgtgaaa
gtatatgaaaagttgatgaagatcaacctggaagcggcagagttaggtgaaatttcagac
atacacaccaaattgttgagactttccagttctcagggaacaatagaaaccagtcttcag
gatatcgacagcagattatctccaggtggatcactggcagacgcatgggcacatcaagaa
ggcactcatccgaaagacagaaatgtagaaaaactacaagtcctgttaaattgcatgaca
gagatttactatcagttcaaaaaagacaaagcagaacgtagattagcttataatgaagaa
caaatccacaaatttgataagcaaaaactgtattaccatgccacaaaagctatgacgcac
tttacagatgaatgtgttaaaaagtatgaggcatttttgaataagtcagaagaatggata
agaaagatgcttcatcttaggaaacagttattatcgctgactaatcagtgttttgatatt
gaagaagaagtatcaaaatatcaagaatatactaatgagttacaagaaactctgcctcag
aaaatgtttacagcttccagtggaatcaaacataccatgaccccaatttatccaagttct
aacacattagtagaaatgactcttggtatgaagaaattaaaggaagagatggaaggggtg
gttaaagaacttgctgaaaataaccacattttagaaaggtttggctctttaaccatggat
ggtggccttcgcaacgttgactgtctttag

DBGET integrated database retrieval system