KEGG   Homo sapiens (human): 2922
Entry
2922              CDS       T01001                                 

Gene name
GRP, BN, GRP-10, preproGRP, proGRP
Definition
(RefSeq) gastrin releasing peptide
  KO
K05224  gastrin-releasing peptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2922 (GRP)
SSDB
Motif
Pfam: Bombesin
Other DBs
NCBI-GeneID: 2922
NCBI-ProteinID: NP_002082
OMIM: 137260
HGNC: 4605
Ensembl: ENSG00000134443
Vega: OTTHUMG00000132760
Pharos: P07492(Tbio)
CPD: C15866 C16115
UniProt: P07492
LinkDB
Position
18q21.32
AA seq 148 aa
MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSS
VSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFK
DVGSKGKVGRLSAPGSQREGRNPQLNQQ
NT seq 447 nt   +upstreamnt  +downstreamnt
atgcgcggccgtgagctcccgctggtcctgctggcgctggtcctctgcctggcgccccgg
gggcgagcggtcccgctgcctgcgggcggagggaccgtgctgaccaagatgtacccgcgc
ggcaaccactgggcggtggggcacttaatggggaaaaagagcacaggggagtcttcttct
gtttctgagagagggagcctgaagcagcagctgagagagtacatcaggtgggaagaagct
gcaaggaatttgctgggtctcatagaagcaaaggagaacagaaaccaccagccacctcaa
cccaaggccctgggcaatcagcagccttcgtgggattcagaggatagcagcaacttcaaa
gatgtaggttcaaaaggcaaagttggtagactctctgctccaggttctcaacgtgaagga
aggaacccccagctgaaccagcaatga

KEGG   Homo sapiens (human): 4828
Entry
4828              CDS       T01001                                 

Gene name
NMB
Definition
(RefSeq) neuromedin B
  KO
K05223  neuromedin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4828 (NMB)
SSDB
Motif
Pfam: Bombesin
Other DBs
NCBI-GeneID: 4828
NCBI-ProteinID: NP_066563
OMIM: 162340
HGNC: 7842
Ensembl: ENSG00000197696
Vega: OTTHUMG00000148666
Pharos: P08949(Tbio)
CPD: C15865
UniProt: P08949
LinkDB
Position
15q25.2
AA seq 121 aa
MARRAGGARMFGSLLLFALLAAGVAPLSWDLPEPRSRASKIRVHSRGNLWATGHFMGKKS
LEPSSPSPLGTAPHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQ
K
NT seq 366 nt   +upstreamnt  +downstreamnt
atggcccggcgggcggggggcgctcggatgttcggcagcctcctgctcttcgccctgctc
gctgccggcgtcgccccgctcagctgggatctcccggagccccgcagccgagccagcaag
atccgagtgcactcgcgaggcaacctctgggccaccggtcacttcatgggcaagaagagt
ctggagccttccagcccatccccattggggacagctccccacacctccctgagggaccag
cgactgcagctgagtcatgatctgctcggaatcctcctgctaaagaaggctctgggcgtg
agcctcagccgccccgcaccccaaatccagtacaggaggctgctggtacaaatactgcag
aaatga

DBGET integrated database retrieval system