KEGG   Homo sapiens (human): 2925
Entry
2925              CDS       T01001                                 

Gene name
GRPR, BB2, BB2R
Definition
(RefSeq) gastrin releasing peptide receptor
  KO
K04169  gastrin-releasing peptide receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    2925 (GRPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2925 (GRPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2925 (GRPR)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Bombesin
    2925 (GRPR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 2925
NCBI-ProteinID: NP_005305
OMIM: 305670
HGNC: 4609
Ensembl: ENSG00000126010
Vega: OTTHUMG00000021189
Pharos: P30550(Tchem)
UniProt: P30550 X5D7H2
LinkDB
Position
Xp22.2
AA seq 384 aa
MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNIT
LIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ
LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSD
LHPFHEESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS
AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLH
FVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS
LKSTNPSVATFSLINGNICHERYV
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggctctaaatgactgtttccttctgaacttggaggtggaccatttcatgcactgcaac
atctccagtcacagtgcggatctccccgtgaacgatgactggtcccacccggggatcctc
tatgtcatccctgcagtttatggggttatcattctgataggcctcattggcaacatcact
ttgatcaagatcttctgtacagtcaagtccatgcgaaacgttccaaacctgttcatttcc
agtctggctttgggagacctgctcctcctaataacgtgtgctccagtggatgccagcagg
tacctggctgacagatggctatttggcaggattggctgcaaactgatcccctttatacag
cttacctctgttggggtgtctgtcttcacactcacggcgctctcggcagacagatacaaa
gccattgtccggccaatggatatccaggcctctcatgccctgatgaagatctgcctcaaa
gccgcctttatctggatcatctccatgctgctggccattccagaggccgtgttttctgac
ctccatcccttccatgaggaaagcaccaaccagaccttcattagctgtgccccataccca
cactctaatgagcttcaccccaaaatccattctatggcttcctttctggtcttctacgtc
attccactgtcgatcatctctgtttactactacttcattgctaaaaatctgatccagagt
gcttacaatcttcccgtggaagggaatatacatgtcaagaagcagattgaatcccggaag
cgacttgccaagacagtgctggtgtttgtgggcctgttcgccttctgctggctccccaat
catgtcatctacctgtaccgctcctaccactactctgaggtggacacctccatgctccac
tttgtcaccagcatctgtgcccgcctcctggccttcaccaactcctgcgtgaaccccttt
gccctctacctgctgagcaagagtttcaggaaacagttcaacactcagctgctctgttgc
cagcctggcctgatcatccggtctcacagcactggaaggagtacaacctgcatgacctcc
ctcaagagtaccaacccctccgtggccacctttagcctcatcaatggaaacatctgtcac
gagcggtatgtctag

KEGG   Homo sapiens (human): 4829
Entry
4829              CDS       T01001                                 

Gene name
NMBR, BB1, BB1R, NMB-R
Definition
(RefSeq) neuromedin B receptor
  KO
K04168  neuromedin B receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4829 (NMBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4829 (NMBR)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Bombesin
    4829 (NMBR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4
Other DBs
NCBI-GeneID: 4829
NCBI-ProteinID: NP_002502
OMIM: 162341
HGNC: 7843
Ensembl: ENSG00000135577
Vega: OTTHUMG00000015704
Pharos: P28336(Tchem)
UniProt: P28336
LinkDB
Position
6q24.1
AA seq 390 aa
MPSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLG
NIMLVKIFITNSAMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIP
VIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGALLRTCVKAMGIWVVSVLLAVPEAV
FSEVARISSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLAIISIYYYHIAKTLI
KSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFIFCWFPNHILYMYRSFNYNEIDPSL
GHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKSYQERGTSYLLSSSAV
RMTSLKSNAKNMVTNSVLLNGHSMKQEMAL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccctctaagtctctttccaacctctcggtgaccaccggcgcgaatgagagcggttcc
gttcccgaggggtgggaaagggatttcctgccggcctcggacgggaccaccacggagttg
gtgatccgctgtgtgatcccgtccctctacctgctcatcatcaccgtgggcttgctgggc
aacatcatgctggtgaagatcttcatcaccaacagcgccatgaggagcgtccccaacatc
ttcatctctaacctggcggccggggacttgctgctgctgctcacctgcgtcccggtggac
gcctcgcgctacttcttcgacgagtggatgtttggcaaggtgggctgcaaactgatccct
gtcatccagctcacttccgtgggggtttccgtgttcactctcactgccctcagcgccgac
aggtacagagccatcgttaaccccatggacatgcagacgtcaggggcattgctgcggacc
tgtgtgaaggccatgggtatctgggtggtctccgtgttgctggcagttcccgaagcggtg
ttttcagaagtggctcgcatcagtagcttggataatagcagcttcacagcatgtatccca
taccctcaaacagatgaattacatccaaagattcattcagtgctcattttcttggtctat
ttcctcataccacttgctattattagcatttattattatcatattgcaaagaccttaatt
aaaagcgcacacaatcttcctggagaatacaatgaacataccaaaaaacagatggaaaca
cggaaacgcctggctaaaattgtgcttgtctttgtgggctgtttcatcttctgttggttt
ccaaaccacatcctttacatgtatcggtctttcaactataatgagattgatccatctcta
ggccacatgattgtcaccttagttgcccgggttctcagttttggcaattcttgtgtcaac
ccatttgctctttacctactcagtgaaagcttcaggaggcatttcaacagccaactctgc
tgtgggaggaagtcctatcaagagagaggaaccagctacctactcagctcttcagcggtg
cgtatgacatctctgaaaagcaatgctaagaacatggtgaccaattctgttttactaaat
gggcacagcatgaagcaggaaatggcactgtga

KEGG   Homo sapiens (human): 680
Entry
680               CDS       T01001                                 

Gene name
BRS3, BB3, BB3R, BBR3
Definition
(RefSeq) bombesin receptor subtype 3
  KO
K04170  bombesin receptor subtype-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    680 (BRS3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    680 (BRS3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Bombesin
    680 (BRS3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx EI24
Other DBs
NCBI-GeneID: 680
NCBI-ProteinID: NP_001718
OMIM: 300107
HGNC: 1113
Ensembl: ENSG00000102239
Vega: OTTHUMG00000022726
Pharos: P32247(Tchem)
UniProt: P32247
LinkDB
Position
Xq26.3
AA seq 399 aa
MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISV
GILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGC
KVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFAL
PEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLI
ARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQT
YVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADT
SLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggctcaaaggcagcctcactcacctaatcagactttaatttcaatcacaaatgacaca
gaatcatcaagctctgtggtttctaacgataacacaaataaaggatggagcggggacaac
tctccaggaatagaagcattgtgtgccatctatattacttatgctgtgatcatttcagtg
ggcatccttggaaatgctattctcatcaaagtctttttcaagaccaaatccatgcaaaca
gttccaaatattttcatcaccagcctggcttttggagatcttttacttctgctaacttgt
gtgccagtggatgcaactcactaccttgcagaaggatggctgttcggaagaattggttgt
aaggtgctctctttcatccggctcacttctgttggtgtgtcagtgttcacattaacaatt
ctcagcgctgacagatacaaggcagttgtgaagccacttgagcgacagccctccaatgcc
atcctgaagacttgtgtaaaagctggctgcgtctggatcgtgtctatgatatttgctcta
cctgaggctatattttcaaatgtatacacttttcgagatcccaataaaaatatgacattt
gaatcatgtacctcttatcctgtctctaagaagctcttgcaagaaatacattctctgctg
tgcttcttagtgttctacattattccactctctattatctctgtctactattccttgatt
gctaggaccctttacaaaagcaccctgaacatacctactgaggaacaaagccatgcccgt
aagcagattgaatcccgaaagagaattgccagaacggtattggtgttggtggctctgttt
gccctctgctggttgccaaatcacctcctgtacctctaccattcattcacttctcaaacc
tatgtagacccctctgccatgcatttcattttcaccattttctctcgggttttggctttc
agcaattcttgcgtaaacccctttgctctctactggctgagcaaaagcttccagaagcat
tttaaagctcagttgttctgttgcaaggcggagcggcctgagcctcctgttgctgacacc
tctcttaccaccctggctgtgatgggaacggtcccgggcactgggagcatacagatgtct
gaaattagtgtgacctcgttcactgggtgtagtgtgaagcaggcagaggacagattctag

DBGET integrated database retrieval system