KEGG   Homo sapiens (human): 2932Help
Entry
2932              CDS       T01001                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase 3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04012  ErbB signaling pathway
hsa04062  Chemokine signaling pathway
hsa04110  Cell cycle
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04510  Focal adhesion
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04657  IL-17 signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04728  Dopaminergic synapse
hsa04910  Insulin signaling pathway
hsa04916  Melanogenesis
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa05010  Alzheimer disease
hsa05135  Yersinia infection
hsa05160  Hepatitis C
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05215  Prostate cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06114  PI3K signaling (viruses)
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06169  Measles virus (MV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00175  KSHV LANA to Wnt signaling pathway
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
N00683  CD80/CD86-CD28-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    2932 (GSK3B)
   04310 Wnt signaling pathway
    2932 (GSK3B)
   04340 Hedgehog signaling pathway
    2932 (GSK3B)
   04390 Hippo signaling pathway
    2932 (GSK3B)
   04151 PI3K-Akt signaling pathway
    2932 (GSK3B)
   04150 mTOR signaling pathway
    2932 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    2932 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2932 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    2932 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    2932 (GSK3B)
   04657 IL-17 signaling pathway
    2932 (GSK3B)
   04662 B cell receptor signaling pathway
    2932 (GSK3B)
   04062 Chemokine signaling pathway
    2932 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    2932 (GSK3B)
   04917 Prolactin signaling pathway
    2932 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    2932 (GSK3B)
   04919 Thyroid hormone signaling pathway
    2932 (GSK3B)
   04916 Melanogenesis
    2932 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    2932 (GSK3B)
   04722 Neurotrophin signaling pathway
    2932 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    2932 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2932 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    2932 (GSK3B)
   05225 Hepatocellular carcinoma
    2932 (GSK3B)
   05226 Gastric cancer
    2932 (GSK3B)
   05217 Basal cell carcinoma
    2932 (GSK3B)
   05215 Prostate cancer
    2932 (GSK3B)
   05213 Endometrial cancer
    2932 (GSK3B)
   05224 Breast cancer
    2932 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    2932 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    2932 (GSK3B)
   04931 Insulin resistance
    2932 (GSK3B)
   04934 Cushing syndrome
    2932 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    2932 (GSK3B)
  09172 Infectious disease: viral
   05162 Measles
    2932 (GSK3B)
   05160 Hepatitis C
    2932 (GSK3B)
   05163 Human cytomegalovirus infection
    2932 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    2932 (GSK3B)
   05165 Human papillomavirus infection
    2932 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    2932 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2932 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    2932 (GSK3B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     2932 (GSK3B)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   2932 (GSK3B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    2932 (GSK3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Kdo ABC1
Motif
Other DBs
NCBI-GeneID: 2932
NCBI-ProteinID: NP_001139628
OMIM: 605004
HGNC: 4617
Ensembl: ENSG00000082701
Vega: OTTHUMG00000133765
Pharos: P49841(Tclin)
UniProt: P49841 Q6FI27
LinkDB All DBs
Structure
PDB: 

Position
3q13.33
AA seq 420 aa AA seqDB search
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccggtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggacggcagcaaggtgacaacagtg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggtcgccatcaagaaagtattgcaggacaagagatttaagaatcgagagctccagatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactccagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatttatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccgcagaacctcttgttggatcctgatactgctgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgctggctgtgtgttggctgagctgttactaggacaaccaatatttccaggggat
agtggtgtggatcagttggtagaaataatcaaggtcctgggaactccaacaagggagcaa
atcagagaaatgaacccaaactacacagaatttaaattccctcaaattaaggcacatcct
tggactaaggtcttccgaccccgaactccaccggaggcaattgcactgtgtagccgtctg
ctggagtatacaccaactgcccgactaacaccactggaagcttgtgcacattcatttttt
gatgaattacgggacccaaatgtcaaactaccaaatgggcgagacacacctgcactcttc
aacttcaccactcaagaactgtcaagtaatccacctctggctaccatccttattcctcct
catgctcggattcaagcagctgcttcaacccccacaaatgccacagcagcgtcagatgct
aatactggagaccgtggacagaccaataatgctgcttctgcatcagcttccaactccacc
tga

KEGG   Homo sapiens (human): 8312Help
Entry
8312              CDS       T01001                                 

Gene name
AXIN1, AXIN, PPP1R49
Definition
(RefSeq) axin 1
  KO
K02157  axin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
Disease
H00048  Hepatocellular carcinoma
H00934  Caudal duplication anomaly
H01667  Medulloblastoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8312 (AXIN1)
   04390 Hippo signaling pathway
    8312 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    8312 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8312 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    8312 (AXIN1)
   05225 Hepatocellular carcinoma
    8312 (AXIN1)
   05226 Gastric cancer
    8312 (AXIN1)
   05217 Basal cell carcinoma
    8312 (AXIN1)
   05213 Endometrial cancer
    8312 (AXIN1)
   05224 Breast cancer
    8312 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    8312 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    8312 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    8312 (AXIN1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     8312 (AXIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Motif
Other DBs
NCBI-GeneID: 8312
NCBI-ProteinID: NP_003493
OMIM: 603816
HGNC: 903
Ensembl: ENSG00000103126
Vega: OTTHUMG00000064930
Pharos: O15169(Tbio)
UniProt: O15169 A0A0S2Z4R0
LinkDB All DBs
Structure
PDB: 

Position
16p13.3
AA seq 862 aa AA seqDB search
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFA
CTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPA
MFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPT
LNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREP
VNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLR
TPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVH
HSTARPKEQVEAEATRRAQSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGV
ACKRNAKKAESGKSASTEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTGHGSSGTRKPQ
PHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKR
ASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPC
DSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEV
REDEAVLPVFEEKIIGKVEKVD
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccaagagcagggtttccccttggacctcggagcaagtttcaccgaagatgct
ccccgacccccagtgcctggtgaggagggagaactggtgtccacagacccgaggcccgcc
agctacagtttctgctccgggaaaggtgttggcattaaaggtgagacttcgacggccact
ccgaggcgctcggatctggacctggggtatgagcctgagggcagtgcctcccccacccca
ccatacttgaagtgggctgagtcactgcattccctgctggatgaccaagatgggataagc
ctgttcaggactttcctgaagcaggagggctgtgccgacttgctggacttctggtttgcc
tgcactggcttcaggaagctggagccctgtgactcgaacgaggagaagaggctgaagctg
gcgagagccatctaccgaaagtacattcttgataacaatggcatcgtgtcccggcagacc
aagccagccaccaagagcttcataaagggctgcatcatgaagcagctgatcgatcctgcc
atgtttgaccaggcccagaccgaaatccaggccactatggaggaaaacacctatccctcc
ttccttaagtctgatatttatttggaatatacgaggacaggctcggagagccccaaagtc
tgtagtgaccagagctctgggtcagggacagggaagggcatatctggatacctgccgacc
ttaaatgaagatgaggaatggaagtgtgaccaggacatggatgaggacgatggcagagac
gctgctccccccggaagactccctcagaagctgctcctggagacagctgccccgagggtc
tcctccagtagacggtacagcgaaggcagagagttcaggtatggatcctggcgggagcca
gtcaacccctattatgtcaatgccggctatgccctggccccagccaccagtgccaacgac
agcgagcagcagagcctgtccagcgatgcagacaccctgtccctcacggacagcagcgtg
gatgggatccccccatacaggatccgtaagcagcaccgcagggagatgcaggagagcgtg
caggtcaatgggcgggtgcccctacctcacattccccgcacgtaccgggtgccgaaggag
gtccgcgtggagcctcagaagttcgcggaggagctcatccaccgcctggaggctgtgcag
cgcacgcgggaggccgaggagaagctggaggagcggctgaagcgcgtgcgcatggaggag
gaaggtgaggacggcgatccatcgtcagggcccccagggccgtgtcacaagctgcctccc
gcccccgcttggcaccacttcccgccccgctgtgtggacatgggctgtgccgggctccgg
gatgcacacgaggagaaccctgagagcatcctggacgagcacgtacagcgtgtgctgagg
acacctggccgccagtcgcctgggcctggccatcgctccccggacagtgggcacgtggcc
aagatgccagtggcactggggggtgccgcctcggggcacgggaagcacgtacccaagtca
ggggcgaagctggacgcggccggcctgcaccaccaccgacacgtccaccaccacgtccac
cacagcacagcccggcccaaggagcaggtggaggccgaggccacccgcagggcccagagc
agcttcgcctggggcctggaaccacacagccatggggcaaggtcccgaggctactcagag
agtgttggcgctgcccccaacgccagtgatggcctcgcccacagtgggaaggtgggcgtg
gcgtgcaaaagaaatgccaagaaggctgagtcggggaagagcgccagcaccgaggtgcca
ggtgcctcggaggatgcggagaagaaccagaaaatcatgcagtggatcattgagggggaa
aaggagatcagcaggcaccgcaggaccggccacgggtcttcggggacgaggaagccacag
ccccatgagaactccagacccttgtcccttgagcacccctgggccggccctcagctccgg
acctccgtgcagccctcccacctcttcatccaagaccccaccatgccaccccacccagct
cccaaccccctaacccagctggaggaggcgcgccgacgtctggaggaggaagaaaagaga
gccagccgagcaccctccaagcagaggtatgtgcaggaggttatgcggcggggacgcgcc
tgcgtcaggccagcgtgcgcgccggtgctgcacgtggtaccagccgtgtcggacatggag
ctctccgagacagagacaagatcgcagaggaaggtgggcggcgggagtgcccagccgtgt
gacagcatcgttgtggcgtactacttctgcggggaacccatcccctaccgcaccctggtg
aggggccgcgctgtcaccctgggccagttcaaggagctgctgaccaaaaagggcagctac
agatactacttcaagaaagtgagcgacgagtttgactgtggggtggtgtttgaggaggtt
cgagaggacgaggccgtcctgcccgtctttgaggagaagatcatcggcaaagtggagaag
gtggactga

KEGG   Homo sapiens (human): 8313Help
Entry
8313              CDS       T01001                                 

Gene name
AXIN2, AXIL, ODCRCS
Definition
(RefSeq) axin 2
  KO
K04385  axin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00857  Oligodontia-colorectal cancer syndrome
H01667  Medulloblastoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8313 (AXIN2)
   04390 Hippo signaling pathway
    8313 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    8313 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8313 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    8313 (AXIN2)
   05225 Hepatocellular carcinoma
    8313 (AXIN2)
   05226 Gastric cancer
    8313 (AXIN2)
   05217 Basal cell carcinoma
    8313 (AXIN2)
   05213 Endometrial cancer
    8313 (AXIN2)
   05224 Breast cancer
    8313 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    8313 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    8313 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8313 (AXIN2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    8313 (AXIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS DIX AXIN1_TNKS_BD Axin_b-cat_bind
Motif
Other DBs
NCBI-GeneID: 8313
NCBI-ProteinID: NP_004646
OMIM: 604025
HGNC: 904
Ensembl: ENSG00000168646
Vega: OTTHUMG00000179353
Pharos: Q9Y2T1(Tchem)
UniProt: Q9Y2T1
LinkDB All DBs
Position
17q24.1
AA seq 843 aa AA seqDB search
MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMPVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEREGSELTLNSREGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSL
LPPGGKLPPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVH
CFCPGGSEYYCYSKCKSHSKAPETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAP
GGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRH
HLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQ
QRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVE
RID
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgctatgttggtgacttgcctcccggaccccagcagcagcttccgtgaggat
gccccgcggcccccagtgccaggggaagaaggggagaccccaccgtgtcagccaggggtg
ggcaagggccaggtcaccaaacccatgcctgtctcttccaacaccaggcggaacgaagat
gggttgggggagccggaggggcgggcatctccggattcccctctgacccggtggaccaag
tccttacactccttattgggcgatcaagacggtgcttacctgttccgaactttcctggag
agggagaaatgcgtggataccttagacttctggtttgcctgcaatggattcaggcagatg
aacctgaaggataccaaaactttacgagtagccaaagcgatctacaaaaggtacattgag
aacaacagcattgtctccaagcagctgaagcctgccaccaagacctacataagagatggc
atcaagaagcagcagattgattccatcatgtttgaccaggcgcagaccgagatccagtcg
gtgatggaggaaaatgcctaccagatgtttttgacttctgatatatacctcgaatatgtg
aggagtgggggagaaaacacagcttacatgagtaatgggggactcgggagcctaaaggtc
gtgtgtggctatctccccaccttgaatgaagaagaggagtggacttgtgccgacttcaag
tgcaaactttcgccaaccgtggttggcttgtccagcaaaactctgagggccacggcgagt
gtgaggtccacggaaactgttgacagtggatacaggtccttcaagaggagcgatcctgtt
aatccttatcacataggttctggctatgtctttgcaccagccaccagcgccaacgacagt
gagatatccagtgatgcgctgacggatgattccatgtccatgacggacagcagtgtagat
ggaattcctccttatcgtgtgggcagtaagaaacagctccagagagaaatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcatttcccgagaacccaccgcctgcccaag
gagatgacccccgtggaacccgccacctttgcagctgagctgatctcgaggctggaaaag
ctgaagctggagttggagagccgccacagcctggaggagcgcctgcagcagatccgagag
gatgaagagagagagggctccgagctcacactcaattcgcgggagggggcgcccacgcag
caccccctctccctactgccctccggcagctacgaggaagacccgcagacgatactggac
gatcacctgtccagggtcctcaagacccctggctgccagtctccaggcgtaggccgctat
agcccccgctcccgctccccggaccaccaccaccaccaccattcgcagtaccactccctg
ctcccgcccggtggcaagctgcctcccgcggccgcctcgccgggcgcctgccccctcctc
gggggcaaaggctttgtgaccaagcagacgacgaagcatgtccaccaccactacatccac
caccatgccgtccccaagaccaaggaggagatcgaggcggaggccacgcagcgggtgcac
tgcttctgccctgggggcagcgagtattactgctactcgaaatgcaaaagccactccaag
gctccggaaaccatgcccagcgagcagtttggcggcagcagaggcagtaccttgcccaaa
cgcaatgggaaaggcacggagccgggcctggccctgcccgccagggaaggaggggccccc
ggcggagctggggccctgcagcttccccgggaggaaggagacaggtcgcaggatgtctgg
cagtggatgctggagagtgagcggcagagcaagcccaagccccatagtgcccaaagcaca
aaaaaggcctaccccttggagtctgcccgctcgtctccaggcgaacgagccagccggcac
catctgtgggggggcaacagcgggcacccccgcaccaccccccgtgcccacctgttcacc
caggaccctgcgatgcctcccctgaccccacccaacacgctggctcagctggaggaggcc
tgtcgcaggctagctgaggtgtcgaagcccccaaagcagcggtgctgtgtggccagtcag
cagagggacaggaatcattcggccactgttcagacgggagccacacccttctccaatcca
agcctggctccagaagatcacaaagagccaaagaaactggcaggtgtccacgcgctccag
gccagtgagttggttgtcacttactttttctgtggggaagaaattccataccggaggatg
ctgaaggctcagagcttgaccctgggccactttaaagagcagctcagcaaaaagggaaat
tataggtattacttcaaaaaagcaagcgatgagtttgcctgtggagcggtgtttgaggag
atctgggaggatgagacggtgctcccgatgtatgaaggccggattctgggcaaagtggag
cggatcgattga

DBGET integrated database retrieval system