KEGG   Homo sapiens (human): 2940Help
Entry
2940              CDS       T01001                                 

Gene name
GSTA3, GSTA3-3, GTA3
Definition
(RefSeq) glutathione S-transferase alpha 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2940 (GSTA3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2940 (GSTA3)
   00982 Drug metabolism - cytochrome P450
    2940 (GSTA3)
   00983 Drug metabolism - other enzymes
    2940 (GSTA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2940 (GSTA3)
   05204 Chemical carcinogenesis
    2940 (GSTA3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2940 (GSTA3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2940 (GSTA3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2940 (GSTA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2940 (GSTA3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2940 (GSTA3)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2940 (GSTA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_C DUF3825 GST_N_3
Motif
Other DBs
NCBI-GeneID: 2940
NCBI-ProteinID: NP_000838
OMIM: 605449
HGNC: 4628
Ensembl: ENSG00000174156
Vega: OTTHUMG00000014865
Pharos: Q16772(Tbio)
UniProt: Q16772
LinkDB All DBs
Structure
PDB: 

Position
6p12.2
AA seq 222 aa AA seqDB search
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK
IALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPL
LKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagggaagcccaagcttcactacttcaatggacggggcagaatggagcccatccgg
tggctcttggctgcagctggagtggagtttgaagagaaatttataggatctgcagaagat
ttgggaaagttaagaaatgatgggagtttgatgttccagcaagtaccaatggttgagatt
gatgggatgaagttggtacagaccagagccattctcaactacattgccagcaaatacaac
ctctacgggaaagacataaaggagagagccctaattgatatgtatacagaaggtatggca
gatttgaatgaaatgatccttcttctgcccttatgtcgacctgaggaaaaagatgccaag
attgccttgatcaaagagaaaacaaaaagtcgctatttccctgccttcgaaaaagtgtta
cagagccatggacaagactaccttgttggcaacaagctgagccgggctgacattagcctg
gtggaacttctctactatgtggaagagcttgactccagccttatctccaacttccctctg
ctgaaggccctgaaaaccagaatcagcaacctgcccacggtgaagaagtttctacagcct
ggcagcccaaggaagcctcccgcagatgcaaaagctttagaagaagccagaaagattttc
aggttttaa

DBGET integrated database retrieval system