KEGG   Homo sapiens (human): 2948Help
Entry
2948              CDS       T01001                                 

Gene name
GSTM4, GSTM4-4, GTM4
Definition
(RefSeq) glutathione S-transferase mu 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2948 (GSTM4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2948 (GSTM4)
   00982 Drug metabolism - cytochrome P450
    2948 (GSTM4)
   00983 Drug metabolism - other enzymes
    2948 (GSTM4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2948 (GSTM4)
   05204 Chemical carcinogenesis
    2948 (GSTM4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2948 (GSTM4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2948 (GSTM4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2948 (GSTM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2948 (GSTM4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2948 (GSTM4)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2948 (GSTM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_C_2 GST_N_3 Bromo_TP
Motif
Other DBs
NCBI-GeneID: 2948
NCBI-ProteinID: NP_000841
OMIM: 138333
HGNC: 4636
Ensembl: ENSG00000168765
Vega: OTTHUMG00000011642
Pharos: Q03013(Tbio)
UniProt: Q03013 A0A140VKE3
LinkDB All DBs
Structure
PDB: 

Position
1p13.3
AA seq 218 aa AA seqDB search
MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDF
EKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgacactggggtactgggacatccgcgggctggcccacgccatccgcctgctc
ctggaatacacagactcaagctacgaggaaaagaagtatacgatgggggacgctcctgac
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatggggctcacaagatcacccagagcaacgccatcctgtgctacatt
gcccgcaagcacaacctgtgtggggagacagaagaggagaagattcgtgtggacattttg
gagaaccaggctatggacgtctccaatcagctggccagagtctgctacagccctgacttt
gagaaactgaagccagaatacttggaggaacttcctacaatgatgcagcacttctcacag
ttcctggggaagaggccatggtttgttggagacaagatcacctttgtagatttcctcgcc
tatgatgtccttgacctccaccgtatatttgagcccaactgcttggacgcctttccaaat
ctgaaggacttcatctcccgctttgagggcttggagaagatctctgcctacatgaagtcc
agccgcttcctcccaaaacctctgtacacaagggtggctgtctggggcaacaagtaa

DBGET integrated database retrieval system