KEGG   Homo sapiens (human): 2965Help
Entry
2965              CDS       T01001                                 

Gene name
GTF2H1, BTF2, P62, TFB1, TFIIH
Definition
(RefSeq) general transcription factor IIH subunit 1
  KO
K03141  transcription initiation factor TFIIH subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    2965 (GTF2H1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    2965 (GTF2H1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    2965 (GTF2H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    2965 (GTF2H1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    2965 (GTF2H1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     2965 (GTF2H1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     2965 (GTF2H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH_TFIIH BSD
Motif
Other DBs
NCBI-GeneID: 2965
NCBI-ProteinID: NP_001135779
OMIM: 189972
HGNC: 4655
Ensembl: ENSG00000110768
Vega: OTTHUMG00000167690
Pharos: P32780(Tbio)
UniProt: P32780 A0A384MTQ8
LinkDB All DBs
Structure
PDB: 

Position
11p15.1
AA seq 548 aa AA seqDB search
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGK
AKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQE
DPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDG
CNGLRYNLTSDIIESIFRTYPAVKMKYAENVPHNMTEKEFWTRFFQSHYFHRDRLNTGSK
DLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKPLDEGYGISSVPSASNSKSIKENSN
AAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSNMDGNSGDADCFQPAVKRAKLQESIEY
EDLGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQ
VLSSSAASSTITALSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFP
VNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQ
SRRLMKKT
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcaacctcatctgaagaagttttgctgattgtaaagaaagtgcgtcaaaagaagcag
gatggagctctgtacctcatggcagaaagaattgcttgggcacctgaaggcaaagataga
tttacaatcagccatatgtatgcagatattaaatgccagaaaattagtccagaaggaaaa
gctaaaattcagcttcagctggtcctacatgcaggggacacaactaacttccatttttcc
aatgaaagcacagcagtgaaagagcgagatgcagtaaaagaccttcttcagcagctgctg
cccaaattcaagaggaaagcaaataaagaactggaagagaagaacagaatgctgcaagaa
gatcctgttttgtttcagctttataaagaccttgttgtgagtcaagtgatcagtgctgag
gaattctgggccaatcgtttaaatgtgaatgcaacagatagttcttccacatccaatcat
aagcaggatgttggcatttctgctgcatttctggctgatgtccggccccaaactgatggc
tgtaacggtctaagatataatttaacttctgatatcattgagtccatatttaggacctat
ccagcagtaaaaatgaaatatgcagaaaatgttccccacaacatgacagagaaggaattc
tggacacgttttttccagtcccattattttcacagggatcggctgaatacagggtcaaag
gatctctttgcagaatgtgccaaaatagatgaaaaaggcctaaaaacaatggtttcatta
ggagtgaaaaacccactactagatttaacagctttggaagataaaccattagatgagggc
tatggcatttcctctgtgccatctgcttccaattctaaatccataaaagagaatagtaat
gctgccatcatcaagagatttaaccatcacagtgccatggtcctggcagctggactcaga
aaacaagaagcacaaaatgaacaaactagtgagcccagcaacatggatggaaattccgga
gatgcagactgctttcagccagcagtcaaaagggcgaaattacaagagtccattgaatat
gaagacttggggaaaaataattctgtaaaaacgattgcactaaacctcaagaagtcagat
aggtattatcatggtccaactccaatccagtcactacagtatgcaacaagtcaggacatt
attaattcttttcaaagtattagacaagaaatggaagcttatacacccaagttaactcag
gttctctcaagtagtgctgccagtagtaccatcacagcactgtcacctggaggggcactt
atgcagggaggaacacagcaagccataaaccagatggtgccaaatgatattcaatctgaa
ttgaaacacttatatgtagctgttggagaacttctacgacatttctggtcctgctttcct
gttaatacgccattcctagaagaaaaggtagtgaaaatgaaaagtaatttggaacgattc
caagttacgaagctctgtccattccaagaaaagattcggagacagtatttaagcacaaat
ttggtaagtcacatagaagagatgctccagacagcctacaacaagctccacacatggcag
tcacggcgtctgatgaagaaaacgtga

KEGG   Homo sapiens (human): 2966Help
Entry
2966              CDS       T01001                                 

Gene name
GTF2H2, BTF2, BTF2P44, T-BTF2P44, TFIIH, p44
Definition
(RefSeq) general transcription factor IIH subunit 2
  KO
K03142  transcription initiation factor TFIIH subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    2966 (GTF2H2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    2966 (GTF2H2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    2966 (GTF2H2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    2966 (GTF2H2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    2966 (GTF2H2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     2966 (GTF2H2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     2966 (GTF2H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ssl1 VWA_2 C1_4 VWA VWA_3 HscB_4_cys IBR
Motif
Other DBs
NCBI-GeneID: 2966
NCBI-ProteinID: NP_001506
OMIM: 601748
HGNC: 4656
Ensembl: ENSG00000145736
Vega: OTTHUMG00000164542
UniProt: Q13888
LinkDB All DBs
Structure
PDB: 

Position
5q13.2
AA seq 395 aa AA seqDB search
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVC
AVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagaacctgaaagaactaagcgatgggaaggaggctatgaaagaacatgggag
attcttaaagaagatgaatctggatcacttaaagctacaatagaagacattctattcaag
gcaaagagaaaaagagtatttgagcaccatggacaagttcgacttggaatgatgcgccac
ctttatgtggtagtagatggatcaagaacaatggaagaccaagatttaaagcctaataga
ctgacgtgtactttaaagttgttggaatactttgtagaggaatattttgatcaaaatcct
attagtcagattggaataattgtaactaagagtaaaagagctgaaaaattgactgaactt
tcaggaaacccaagaaaacatataacgtctttgaagaaagctgtggatatgacctgccat
ggagagccatctctttataattccctaagcatagctatgcagactctaaaacacatgcct
ggacatacaagtcgagaagtactaatcatctttagcagccttacaacttgcgatccatct
aatatttatgatctaatcaagaccctaaaggcagctaaaattagagtatctgttattgga
ttgtctgcagaagttcgcgtttgcactgtacttgctcgtgaaactggtggcacgtaccat
gttattttagatgaaagccattacaaagagttgctcacacatcatgttagtcctcctcct
gctagctcaagttctgaatgctcacttattcgtatgggatttcctcagcacaccattgct
tctttatctgaccaggatgcaaaaccctctttcagcatggcgcatttggatggcaatact
gagccagggcttacattaggaggctatttctgcccacagtgtcgggcaaagtactgtgag
ctacctgttgagtgtaaaatctgtggtcttactttggtgtctgctccccacttggcacgg
tcttaccatcatttgtttcctttggatgcttttcaagaaattcccctagaagaatataat
ggagaaagattttgttatggatgtcagggggaattgaaagaccaacatgtttatgtttgt
gctgtgtgccaaaatgttttctgtgtggactgtgatgtttttgttcatgattctctacac
tgttgccctggctgtattcataagattccagctccttcaggtgtttga

KEGG   Homo sapiens (human): 2967Help
Entry
2967              CDS       T01001                                 

Gene name
GTF2H3, BTF2, P34, TFB4, TFIIH
Definition
(RefSeq) general transcription factor IIH subunit 3
  KO
K03143  transcription initiation factor TFIIH subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    2967 (GTF2H3)
  09124 Replication and repair
   03420 Nucleotide excision repair
    2967 (GTF2H3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    2967 (GTF2H3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    2967 (GTF2H3)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    2967 (GTF2H3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     2967 (GTF2H3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     2967 (GTF2H3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb4
Motif
Other DBs
NCBI-GeneID: 2967
NCBI-ProteinID: NP_001507
OMIM: 601750
HGNC: 4657
Ensembl: ENSG00000111358
Vega: OTTHUMG00000168697
Pharos: Q13889(Tbio)
UniProt: Q13889
LinkDB All DBs
Structure
PDB: 

Position
12q24.31
AA seq 308 aa AA seqDB search
MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVI
ASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMT
KSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNV
IFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQ
LILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAK
KKKLKVSA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggtttcagacgaagatgaattgaatcttctggttattgtagttgatgccaacccaatt
tggtggggaaagcaagcattaaaggaatctcagttcactttatccaaatgcatagatgcc
gtgatggtgctgggaaattcgcatttattcatgaatcgttccaacaaacttgctgtgata
gcaagtcacattcaagaaagccgattcttatatcctggaaagaatggcagacttggagac
ttcttcggagaccctggcaaccctcctgaatttaatccctctgggagtaaagatggaaaa
tacgaacttttaacctcagcaaatgaagttattgttgaagagattaaagatctaatgacc
aaaagtgacataaagggtcaacatacagaaactttgctggcaggatccctggccaaagcc
ctttgctacattcatagaatgaacaaggaagttaaagacaatcaggaaatgaaatcaagg
atattggtgattaaggctgcagaagacagtgcgttgcagtatatgaacttcatgaatgtc
atctttgcagcacagaaacagaatattttgattgatgcctgtgttttagactccgactca
gggctcctccaacaggcttgtgacatcacgggaggactgtacctgaaggtgcctcagatg
ccttctcttctgcagtatttgctgtgggtgtttcttcccgatcaagatcagagatctcag
ttaatcctcccacccccagttcatgttgactacagggctgcttgcttctgtcatcgaaat
ctcattgaaattggttatgtctgttctgtgtgtttgtcaatattctgcaatttcagcccc
atttgtactacgtgcgagacagcctttaaaatttctctgcctccagtgctgaaagccaag
aaaaagaaactgaaagtgtctgcctga

KEGG   Homo sapiens (human): 2968Help
Entry
2968              CDS       T01001                                 

Gene name
GTF2H4, P52, TFB2, TFIIH
Definition
(RefSeq) general transcription factor IIH subunit 4
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    2968 (GTF2H4)
  09124 Replication and repair
   03420 Nucleotide excision repair
    2968 (GTF2H4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    2968 (GTF2H4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    2968 (GTF2H4)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    2968 (GTF2H4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     2968 (GTF2H4)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     2968 (GTF2H4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2 Tfb2_C Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 2968
NCBI-ProteinID: NP_001508
OMIM: 601760
HGNC: 4658
Ensembl: ENSG00000213780
Vega: OTTHUMG00000031043
Pharos: Q92759(Tbio)
UniProt: Q92759 A0A1U9X7S4
LinkDB All DBs
Structure
PDB: 

Position
6p21.33
AA seq 462 aa AA seqDB search
MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRML
FLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRI
ALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLS
QAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQL
SFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGGT
VHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGIT
AQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFEL
LLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaccccttcaaggggactgaaccgagtacacctacaatgcaggaatctgcag
gaattcttagggggcctgagccctggggtattggaccgattgtatgggcaccctgccaca
tgtctggctgtcttcagggagctcccatccttggctaagaactgggtgatgcggatgctc
tttctggagcagcctttgccacaggctgctgtagctctgtgggtaaagaaggaattcagc
aaggctcaggaggaaagtacagggctgctgagcggcctccggatctggcacacacagctg
ctcccaggcgggctccagggcctcatcctcaaccccattttccgccagaacctccgcatt
gcccttctgggtggggggaaggcctggtctgatgacacaagtcagctgggaccagacaag
catgcccgggacgttccctcccttgacaagtacgccgaggagcgatgggaggtggtcttg
cacttcatggtgggctcccccagtgcagctgtcagccaggacttggctcagctcctcagc
caggctgggctcatgaagagtactgaacctggagagccgccctgcattacttccgctggc
ttccagttcctgttgctggacaccccggctcagctctggtactttatgttgcagtatttg
cagacagcccagagccggggcatggacctggtagagattctctccttcctcttccagctc
agcttctctactctgggcaaggattactctgtggaaggtatgagtgattctctgttgaac
ttcctgcaacatctgcgtgagtttgggcttgttttccagaggaagaggaaatctcggcgt
tactaccccacacgcctggccatcaatctctcatcaggtgtctctggagctgggggcact
gtgcatcagccaggtttcattgtcgtggaaaccaattaccgactgtatgcctacacggag
tcggagctgcagattgccctcattgccctcttctctgagatgctctatcggttccccaac
atggtggtggcgcaggtgacccgggagagtgtgcagcaggcaatcgccagtggcatcaca
gcccagcagataatccatttcctaaggacaagagcccacccagtgatgctcaaacagaca
cctgtgctgccccccaccatcaccgaccagatccggctctgggagctggaaagggacaga
ctccggttcactgagggtgtcctgtataaccagttcctgtcgcaagtggactttgagctg
ctgctggcccacgcgcgggagctgggcgtgctcgtgttcgagaactcggccaagcggctc
atggtggtgaccccggccgggcacagcgacgtcaagcgcttttggaagcggcagaaacat
agctcctga

KEGG   Homo sapiens (human): 728340Help
Entry
728340            CDS       T01001                                 

Gene name
GTF2H2C, GTF2H2C_2
Definition
(RefSeq) GTF2H2 family member C
  KO
K03142  transcription initiation factor TFIIH subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    728340 (GTF2H2C)
  09124 Replication and repair
   03420 Nucleotide excision repair
    728340 (GTF2H2C)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    728340 (GTF2H2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    728340 (GTF2H2C)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    728340 (GTF2H2C)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     728340 (GTF2H2C)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     728340 (GTF2H2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ssl1 VWA_2 C1_4 VWA VWA_3 HscB_4_cys IBR
Motif
Other DBs
NCBI-GeneID: 728340
NCBI-ProteinID: NP_001092198
HGNC: 31394
Ensembl: ENSG00000183474
Vega: OTTHUMG00000162365
Pharos: Q6P1K8(Tdark)
UniProt: Q6P1K8
LinkDB All DBs
Structure
PDB: 

Position
5q13.2
AA seq 395 aa AA seqDB search
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKEAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHLSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVC
AVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagaacctgaaagaactaagcgatgggaaggaggctatgaaagaacatgggag
attcttaaagaagatgaatctggatcacttaaagctacaatagaagacattctattcaag
gcaaagagaaaaagagtatttgagcaccatggacaagttcgacttggaatgatgcgccac
ctttatgtggtagtagatggatcaagaacaatggaagaccaagatttaaagcctaataga
ctgacgtgtactttaaagttgttggaatactttgtagaggaatattttgatcaaaatcct
attagtcagattggaataattgtaactaagagtaaaagagctgaaaaattgactgaactt
tcaggaaacccaagaaaacatataacgtctttgaaggaagctgtggatatgacctgccat
ggagagccatctctttataattccctaagcatggctatgcagactctaaaacacatgcct
ggacatacaagtcgagaagtactaatcatctttagcagccttacaacttgcgatccatct
aatatttatgatctaatcaagaccctaaaggcagctaaaattagagtatctgttattgga
ttgtctgcagaagttcgcgtttgcactgtacttgctcgtgaaactggtggcacgtaccat
gttattttagatgaaagccattacaaagagttgctcacacatcatcttagtcctcctcct
gctagctcaagttctgaatgctcacttattcgtatgggatttcctcagcacaccattgct
tctttatctgaccaggatgcaaaaccctctttcagcatggcgcatttggatggcaatact
gagccagggcttacattaggaggctatttctgcccacagtgtcgggcaaagtactgtgag
ctacctgttgaatgtaaaatctgtggtcttactttggtgtctgctccccacttggcacgg
tcttaccatcatttgtttcctttggatgcttttcaagaaattcccctagaagaatataat
ggagaaagattttgttatggatgtcagggggaattgaaagaccaacatgtttatgtttgt
gctgtgtgccaaaatgttttctgtgtggactgtgatgtttttgttcatgattctctacac
tgttgccctggctgtattcataagattccagctccttcaggtgtttga

KEGG   Homo sapiens (human): 730394Help
Entry
730394            CDS       T01001                                 

Gene name
GTF2H2C_2, GTF2H2D
Definition
(RefSeq) GTF2H2 family member C, copy 2
  KO
K03142  transcription initiation factor TFIIH subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    730394 (GTF2H2C_2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    730394 (GTF2H2C_2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    730394 (GTF2H2C_2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    730394 (GTF2H2C_2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    730394 (GTF2H2C_2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     730394 (GTF2H2C_2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     730394 (GTF2H2C_2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ssl1 VWA_2 C1_4 VWA VWA_3 HscB_4_cys IBR
Motif
Other DBs
NCBI-GeneID: 730394
NCBI-ProteinID: NP_001035955
HGNC: 35418
Pharos: Q6P1K8(Tdark)
UniProt: Q6P1K8
LinkDB All DBs
Structure
PDB: 

Position
5q13.2
AA seq 395 aa AA seqDB search
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKEAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHLSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVC
AVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagaacctgaaagaactaagcgatgggaaggaggctatgaaagaacatgggag
attcttaaagaagatgaatctggatcacttaaagctacaatagaagacattctattcaag
gcaaagagaaaaagagtatttgagcaccatggacaagttcgacttggaatgatgcgccac
ctttatgtggtagtagatggatcaagaacaatggaagaccaagatttaaagcctaataga
ctgacgtgtactttaaagttgttggaatactttgtagaggaatattttgatcaaaatcct
attagtcagattggaataattgtaactaagagtaaaagagctgaaaaattgactgaactt
tcaggaaacccaagaaaacatataacgtctttgaaggaagctgtggatatgacctgccat
ggagagccatctctttataattccctaagcatggctatgcagactctaaaacacatgcct
ggacatacaagtcgagaagtactaatcatctttagcagccttacaacttgcgatccatct
aatatttatgatttaatcaagaccctaaaggcagctaaaattagagtatctgttattgga
ttgtctgcagaagttcgcgtttgcactgtacttgctcgtgaaactggtggcacgtaccat
gttattttagatgaaagccattacaaagagttgctcacacatcatcttagtcctcctcct
gctagctcaagttctgaatgctcacttattcgtatgggatttcctcagcacaccattgct
tctttatctgaccaggatgcaaaaccctctttcagcatggcgcatttggatggcaatact
gagccagggcttacattaggaggctatttctgcccacagtgtcgggcaaagtactgtgag
ctacctgttgaatgtaaaatctgtggtcttactttggtgtctgctccccacttggcacgg
tcttaccatcatttgtttcctttggatgcttttcaagaaattcccctagaagaatataat
ggagaaagattttgttatggatgtcagggggaattgaaagaccaacatgtttatgtttgt
gctgtgtgccaaaatgttttctgtgtggactgtgatgtttttgttcatgattctctacac
tgttgccctggctgtattcataagattccagctccttcaggtgtttga

DBGET integrated database retrieval system