KEGG   Homo sapiens (human): 2966
Entry
2966              CDS       T01001                                 

Gene name
GTF2H2, BTF2, BTF2P44, T-BTF2P44, TFIIH, p44
Definition
(RefSeq) general transcription factor IIH subunit 2
  KO
K03142  transcription initiation factor TFIIH subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    2966 (GTF2H2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    2966 (GTF2H2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    2966 (GTF2H2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    2966 (GTF2H2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    2966 (GTF2H2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     2966 (GTF2H2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     2966 (GTF2H2)
SSDB
Motif
Pfam: Ssl1 VWA_2 C1_4 VWA VWA_3 HscB_4_cys IBR
Other DBs
NCBI-GeneID: 2966
NCBI-ProteinID: NP_001506
OMIM: 601748
HGNC: 4656
Ensembl: ENSG00000145736
Vega: OTTHUMG00000164542
UniProt: Q13888
LinkDB
Structure
PDB: 

Position
5q13.2
AA seq 395 aa
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVC
AVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggatgaagaacctgaaagaactaagcgatgggaaggaggctatgaaagaacatgggag
attcttaaagaagatgaatctggatcacttaaagctacaatagaagacattctattcaag
gcaaagagaaaaagagtatttgagcaccatggacaagttcgacttggaatgatgcgccac
ctttatgtggtagtagatggatcaagaacaatggaagaccaagatttaaagcctaataga
ctgacgtgtactttaaagttgttggaatactttgtagaggaatattttgatcaaaatcct
attagtcagattggaataattgtaactaagagtaaaagagctgaaaaattgactgaactt
tcaggaaacccaagaaaacatataacgtctttgaagaaagctgtggatatgacctgccat
ggagagccatctctttataattccctaagcatagctatgcagactctaaaacacatgcct
ggacatacaagtcgagaagtactaatcatctttagcagccttacaacttgcgatccatct
aatatttatgatctaatcaagaccctaaaggcagctaaaattagagtatctgttattgga
ttgtctgcagaagttcgcgtttgcactgtacttgctcgtgaaactggtggcacgtaccat
gttattttagatgaaagccattacaaagagttgctcacacatcatgttagtcctcctcct
gctagctcaagttctgaatgctcacttattcgtatgggatttcctcagcacaccattgct
tctttatctgaccaggatgcaaaaccctctttcagcatggcgcatttggatggcaatact
gagccagggcttacattaggaggctatttctgcccacagtgtcgggcaaagtactgtgag
ctacctgttgagtgtaaaatctgtggtcttactttggtgtctgctccccacttggcacgg
tcttaccatcatttgtttcctttggatgcttttcaagaaattcccctagaagaatataat
ggagaaagattttgttatggatgtcagggggaattgaaagaccaacatgtttatgtttgt
gctgtgtgccaaaatgttttctgtgtggactgtgatgtttttgttcatgattctctacac
tgttgccctggctgtattcataagattccagctccttcaggtgtttga

KEGG   Homo sapiens (human): 728340
Entry
728340            CDS       T01001                                 

Gene name
GTF2H2C, GTF2H2C_2
Definition
(RefSeq) GTF2H2 family member C
  KO
K03142  transcription initiation factor TFIIH subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    728340 (GTF2H2C)
  09124 Replication and repair
   03420 Nucleotide excision repair
    728340 (GTF2H2C)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    728340 (GTF2H2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    728340 (GTF2H2C)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    728340 (GTF2H2C)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     728340 (GTF2H2C)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     728340 (GTF2H2C)
SSDB
Motif
Pfam: Ssl1 VWA_2 C1_4 VWA VWA_3 HscB_4_cys IBR
Other DBs
NCBI-GeneID: 728340
NCBI-ProteinID: NP_001092198
HGNC: 31394
Ensembl: ENSG00000183474
Vega: OTTHUMG00000162365
Pharos: Q6P1K8(Tdark)
UniProt: Q6P1K8
LinkDB
Structure
PDB: 
1Z60

Position
5q13.2
AA seq 395 aa
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKEAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHLSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVC
AVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggatgaagaacctgaaagaactaagcgatgggaaggaggctatgaaagaacatgggag
attcttaaagaagatgaatctggatcacttaaagctacaatagaagacattctattcaag
gcaaagagaaaaagagtatttgagcaccatggacaagttcgacttggaatgatgcgccac
ctttatgtggtagtagatggatcaagaacaatggaagaccaagatttaaagcctaataga
ctgacgtgtactttaaagttgttggaatactttgtagaggaatattttgatcaaaatcct
attagtcagattggaataattgtaactaagagtaaaagagctgaaaaattgactgaactt
tcaggaaacccaagaaaacatataacgtctttgaaggaagctgtggatatgacctgccat
ggagagccatctctttataattccctaagcatggctatgcagactctaaaacacatgcct
ggacatacaagtcgagaagtactaatcatctttagcagccttacaacttgcgatccatct
aatatttatgatctaatcaagaccctaaaggcagctaaaattagagtatctgttattgga
ttgtctgcagaagttcgcgtttgcactgtacttgctcgtgaaactggtggcacgtaccat
gttattttagatgaaagccattacaaagagttgctcacacatcatcttagtcctcctcct
gctagctcaagttctgaatgctcacttattcgtatgggatttcctcagcacaccattgct
tctttatctgaccaggatgcaaaaccctctttcagcatggcgcatttggatggcaatact
gagccagggcttacattaggaggctatttctgcccacagtgtcgggcaaagtactgtgag
ctacctgttgaatgtaaaatctgtggtcttactttggtgtctgctccccacttggcacgg
tcttaccatcatttgtttcctttggatgcttttcaagaaattcccctagaagaatataat
ggagaaagattttgttatggatgtcagggggaattgaaagaccaacatgtttatgtttgt
gctgtgtgccaaaatgttttctgtgtggactgtgatgtttttgttcatgattctctacac
tgttgccctggctgtattcataagattccagctccttcaggtgtttga

KEGG   Homo sapiens (human): 730394
Entry
730394            CDS       T01001                                 

Gene name
GTF2H2C_2, GTF2H2D
Definition
(RefSeq) GTF2H2 family member C, copy 2
  KO
K03142  transcription initiation factor TFIIH subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    730394 (GTF2H2C_2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    730394 (GTF2H2C_2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    730394 (GTF2H2C_2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    730394 (GTF2H2C_2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    730394 (GTF2H2C_2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     730394 (GTF2H2C_2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     730394 (GTF2H2C_2)
SSDB
Motif
Pfam: Ssl1 VWA_2 C1_4 VWA VWA_3 HscB_4_cys IBR
Other DBs
NCBI-GeneID: 730394
NCBI-ProteinID: NP_001035955
HGNC: 35418
Ensembl: ENSG00000274675
Pharos: Q6P1K8(Tdark)
UniProt: Q6P1K8
LinkDB
Structure
PDB: 
1Z60

Position
5q13.2
AA seq 395 aa
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKEAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHLSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVC
AVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggatgaagaacctgaaagaactaagcgatgggaaggaggctatgaaagaacatgggag
attcttaaagaagatgaatctggatcacttaaagctacaatagaagacattctattcaag
gcaaagagaaaaagagtatttgagcaccatggacaagttcgacttggaatgatgcgccac
ctttatgtggtagtagatggatcaagaacaatggaagaccaagatttaaagcctaataga
ctgacgtgtactttaaagttgttggaatactttgtagaggaatattttgatcaaaatcct
attagtcagattggaataattgtaactaagagtaaaagagctgaaaaattgactgaactt
tcaggaaacccaagaaaacatataacgtctttgaaggaagctgtggatatgacctgccat
ggagagccatctctttataattccctaagcatggctatgcagactctaaaacacatgcct
ggacatacaagtcgagaagtactaatcatctttagcagccttacaacttgcgatccatct
aatatttatgatttaatcaagaccctaaaggcagctaaaattagagtatctgttattgga
ttgtctgcagaagttcgcgtttgcactgtacttgctcgtgaaactggtggcacgtaccat
gttattttagatgaaagccattacaaagagttgctcacacatcatcttagtcctcctcct
gctagctcaagttctgaatgctcacttattcgtatgggatttcctcagcacaccattgct
tctttatctgaccaggatgcaaaaccctctttcagcatggcgcatttggatggcaatact
gagccagggcttacattaggaggctatttctgcccacagtgtcgggcaaagtactgtgag
ctacctgttgaatgtaaaatctgtggtcttactttggtgtctgctccccacttggcacgg
tcttaccatcatttgtttcctttggatgcttttcaagaaattcccctagaagaatataat
ggagaaagattttgttatggatgtcagggggaattgaaagaccaacatgtttatgtttgt
gctgtgtgccaaaatgttttctgtgtggactgtgatgtttttgttcatgattctctacac
tgttgccctggctgtattcataagattccagctccttcaggtgtttga

DBGET integrated database retrieval system