KEGG   Homo sapiens (human): 29760
Entry
29760             CDS       T01001                                 

Gene name
BLNK, AGM4, BASH, BLNK-S, LY57, SLP-65, SLP65, bca
Definition
(RefSeq) B cell linker
  KO
K07371  B-cell linker protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04662  B cell receptor signaling pathway
hsa05169  Epstein-Barr virus infection
hsa05340  Primary immunodeficiency
Network
nt06120  Calcium signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06165  Epstein-Barr virus (EBV)
nt06220  Calcium signaling
  Element
N00487  BCR-PLCG-Calcineurin signaling pathway
Disease
H00085  Agammaglobulinemias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    29760 (BLNK)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    29760 (BLNK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    29760 (BLNK)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    29760 (BLNK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    29760 (BLNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    29760 (BLNK)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   29760 (BLNK)
SSDB
Motif
Pfam: SH2
Other DBs
NCBI-GeneID: 29760
NCBI-ProteinID: NP_037446
OMIM: 604515
HGNC: 14211
Ensembl: ENSG00000095585
Vega: OTTHUMG00000018827
Pharos: Q8WV28(Tbio)
UniProt: Q8WV28
LinkDB
Position
10q24.1
AA seq 456 aa
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADE
EEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYI
DNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVV
PVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPA
APSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQ
KQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEAL
HRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFG
SVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggacaagcttaataaaataaccgtccccgccagtcagaagttgaggcagcttcaaaag
atggtccatgatattaaaaacaatgaaggtggaataatgaataaaatcaaaaagctaaaa
gtcaaagcacctccaagtgttcctcgaagggactacgcttcagagagccctgctgacgaa
gaggagcagtggtccgatgactttgacagcgactatgaaaatccagatgagcactcggac
tcagagatgtacgtgatgcccgccgaggagaacgctgatgacagctacgagccgcctcca
gtagagcaggaaaccaggccggttcacccagccctgcccttcgccagaggcgagtatata
gacaatcgatcaagccagaggcattccccacccttcagcaagacacttcccagtaagccc
agctggccttcagagaaagcaaggctcacctccaccctgccggccctgactgctttgcag
aaacctcaagtcccacccaaacccaaaggcctccttgaggatgaggctgattatgtggtc
cccgtggaagataatgatgaaaactatattcatcccacagaaagcagttcacctccacct
gaaaaagctcccatggtgaatagatcaaccaagccaaattcctcaacgcccgcctctcct
ccaggaacagcttcaggtcgaaacagtggggcctgggaaaccaagtcacctccaccagct
gcaccatccccgttgccacgggccgggaaaaaaccaacgacaccactgaagacaactcca
gttgcctctcaacagaatgcttcaagtgtttgtgaagaaaaacctatacctgctgaacgc
caccgagggtcaagtcacagacaagaagctgtgcagtcaccagtgtttcctcctgcccag
aaacaaatccaccaaaaacccatacctctgccaagatttacagaagggggaaacccaact
gtggatgggcccctacccagcttttcatctaattccactatttcagaacaggaagctggc
gttctctgcaagccatggtatgctggagcctgtgatcgaaagtctgctgaagaggcattg
cacagatcaaacaaggatggatcatttcttattcggaaaagctctggccatgattccaaa
caaccatatacactagttgtattctttaataagcgagtatataatattcctgtgcgattt
attgaagcaacaaaacaatatgccttgggcagaaagaaaaatggtgaagagtactttgga
agtgttgctgaaatcatcaggaatcatcaacatagtcctttggttcttattgacagtcag
aataacacaaaagattccaccagactgaagtatgcagttaaagtttcataa

DBGET integrated database retrieval system