KEGG   Homo sapiens (human): 29780Help
Entry
29780             CDS       T01001                                 

Gene name
PARVB, CGI-56
Definition
(RefSeq) parvin beta
  KO
K06275  parvin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    29780 (PARVB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    29780 (PARVB)
   04147 Exosome [BR:hsa04147]
    29780 (PARVB)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     29780 (PARVB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29780 (PARVB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CH CH_2 CAMSAP_CH 4HBT
Motif
Other DBs
NCBI-GeneID: 29780
NCBI-ProteinID: NP_037459
OMIM: 608121
HGNC: 14653
Ensembl: ENSG00000188677
Vega: OTTHUMG00000150665
Pharos: Q9HBI1(Tbio)
UniProt: Q9HBI1
LinkDB All DBs
Structure
PDB: 

Position
22q13.31
AA seq 364 aa AA seqDB search
MSSAPRSPTPRPRRMKKDESFLGKLGGTLARKRRAREVSDLQEEGKNAINSPMSPALVDV
HPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLEEDLYDGQV
LQKLLEKLAGCKLNVAEVTQSEIGQKQKLQTVLEAVHDLLRPRGWALRWSVDSIHGKNLV
AILHLLVSLAMHFRAPIRLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEMMMGRFERD
AFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEDYFV
PLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKY
KNVE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgcgccgcgctcgcccaccccgcggccccgcaggatgaagaaggacgagtcg
ttcctgggcaagctgggcggcaccctggccaggaagcggagggcgcgcgaggtgagtgac
ctgcaggaagaaggcaagaatgccatcaactcaccgatgtcccccgccctggtggatgtt
caccctgaagacacccagcttgaggagaacgaggagcgcacgatgattgaccccacttcc
aaggaagaccccaagttcaaggaactggtcaaggtcctcctcgactggattaatgacgtg
ctggtggaggagaggatcattgtgaagcagctggaggaagacctgtatgacggccaggtg
ctgcagaagctcttggaaaaactggcagggtgcaagctgaatgtggctgaggtgacacag
tccgaaatagggcagaaacagaagctgcagacggtgctggaagcagtacatgacctgctg
cggccccgaggctgggcgctccggtggagcgtggactcaattcacgggaagaacctggtg
gccatcctccacctgctggtctctctggccatgcacttcagggcccccatccgccttcct
gagcatgtaacggtgcaggtggtggtcgtgcggaaacgggaaggcctgctgcattccagc
cacatctcggaggagctgaccacaactacagagatgatgatgggccggttcgagcgggat
gccttcgacacgctgttcgaccacgccccggataagctcagcgtggtgaagaagtctctc
atcacttttgtgaacaagcacctgaacaagctgaatttggaggtgacggaactggagacc
cagtttgcagatggcgtgtacctggttctgctcatgggccttctggaagactactttgtt
cctctccaccacttctacctgactccggaaagcttcgatcagaaggtccacaatgtgtcc
ttcgcctttgagctgatgctggacggaggcctcaagaaacccaaggctcgtcctgaagac
gtggttaacttggacctcaaatccaccctgagggttctttacaacctgttcaccaagtac
aagaacgtggagtga

KEGG   Homo sapiens (human): 55742Help
Entry
55742             CDS       T01001                                 

Gene name
PARVA, CH-ILKBP, MXRA2
Definition
(RefSeq) parvin alpha
  KO
K06275  parvin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    55742 (PARVA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    55742 (PARVA)
   04147 Exosome [BR:hsa04147]
    55742 (PARVA)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     55742 (PARVA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   55742 (PARVA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CH CAMSAP_CH CH_2 Sfi1 FlaG
Motif
Other DBs
NCBI-GeneID: 55742
NCBI-ProteinID: NP_060692
OMIM: 608120
HGNC: 14652
Ensembl: ENSG00000197702
Vega: OTTHUMG00000165778
Pharos: Q9NVD7(Tbio)
UniProt: Q9NVD7 J3KNQ4
LinkDB All DBs
Structure
PDB: 

Position
11p15.3
AA seq 372 aa AA seqDB search
MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLP
LSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLA
EDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVD
SVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEA
LSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLM
GLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRV
LYNLFTKYRNVE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggccacctccccgcagaagtcgccttctgtccccaagtctcccactcccaagtcgccc
ccgtcccgcaagaaagatgattccttcttggggaaactcggagggaccctggcccggagg
aagaaagccaaggaggtgtccgagctgcaggaggagggaatgaacgccatcaacctgccc
ctcagcccaattccctttgagctggaccccgaggacacgatgctggaggagaatgaggtg
cgaacaatggtggatccaaactcacgcagtgaccccaagcttcaagaactgatgaaggta
ttaattgactggattaatgatgtgttggttggagaaagaatcattgtgaaagacctagct
gaagatttgtatgatggacaagtcctgcagaagcttttcgagaaactggagagtgagaag
ctaaatgtggctgaggtcacccagtcagagattgctcagaagcaaaaactgcagactgtc
ctggagaagatcaatgaaaccctgaaacttcctcccaggagcatcaagtggaatgtggat
tctgttcatgccaagagcctggtggccatcttacacctgctcgttgctctgtctcagtat
ttccgcgcaccaattcgactcccagaccatgtttccatccaagtggttgtggtccagaaa
cgagaaggaatcctccagtctcggcaaatccaagaggaaataactggtaacacagaggct
ctttccgggaggcatgaacgtgatgcctttgacaccttgttcgaccatgccccagacaag
ctgaatgtggtgaaaaagacactcatcactttcgtgaacaagcacctgaataaactgaac
ctggaggtcacagaactggaaacccagtttgcagatggggtgtacctggtgctgctcatg
gggctcctggagggctactttgtgcccctgcacagcttcttcctgaccccggacagcttt
gaacagaaggtcttgaatgtctcctttgcctttgagctcatgcaagatggagggttggaa
aagccaaaaccgcggccagaagacatagtcaactgtgacctgaaatctacactacgagtg
ttgtacaacctcttcaccaagtaccgtaacgtggagtga

KEGG   Homo sapiens (human): 64098Help
Entry
64098             CDS       T01001                                 

Gene name
PARVG
Definition
(RefSeq) parvin gamma
  KO
K06275  parvin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    64098 (PARVG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    64098 (PARVG)
   04147 Exosome [BR:hsa04147]
    64098 (PARVG)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     64098 (PARVG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   64098 (PARVG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CH CAMSAP_CH
Motif
Other DBs
NCBI-GeneID: 64098
NCBI-ProteinID: NP_001131077
OMIM: 608122
HGNC: 14654
Ensembl: ENSG00000138964
Vega: OTTHUMG00000150473
Pharos: Q9HBI0(Tdark)
UniProt: Q9HBI0 A0A024R4U4
LinkDB All DBs
Position
22q13.31
AA seq 331 aa AA seqDB search
MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLP
EHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLE
EWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLV
EQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFAD
GVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNK
DAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggagccggagttcttgtacgacctgctgcagctccccaagggggtggagcccccagcg
gaggaggagctctcaaaaggaggaaagaagaaatacctgccacccacttcccggaaggac
cccaaatttgaagaactgcagaaggtgttgatggagtggatcaatgccactcttctcccc
gagcacattgtggtccgcagcctggaggaggacatgttcgacgggctcatcctacaccac
ctattccagaggctggcggcgctcaagctggaagcagaggacatcgccctgacagccaca
agccagaagcacaagctcacagtggtgctggaggccgtgaaccggagtctgcagctggag
gagtggcaggccaagtggagcgtggagagcatcttcaacaaggacctgttgtctaccctg
cacctccttgtggccctggccaagcgcttccagcccgacctctccctcccaaccaacgtc
caggtggaggtcatcactatcgagagcaccaaaagtggtctgaagtcagagaagttggtg
gaacagctcactgaatacagcacagacaaggacgagcctccaaaggacgtctttgatgaa
ttatttaagctggctccggagaaagtgaacgcagtgaaagaggccatcgtgaactttgtc
aaccagaagctggaccgcctgggcctgtctgtgcagaatctggacacccagtttgcagat
ggggtcatcttactcttgctgattggacaacttgaaggcttcttcctgcacttaaaggaa
ttctacctcactcccaactctcctgcagaaatgctgcacaacgtcaccctggcgctggag
ctgctgaaggacgagggcctgctcagctgccctgtcagccctgaagatatcgtgaacaag
gatgccaagagcacactgagggtgctctatggtctgttctgcaagcacacgcagaaggca
cacagggacaggacgccccatggagccccgaattga

DBGET integrated database retrieval system