KEGG   Homo sapiens (human): 29801
Entry
29801             CDS       T01001                                 

Gene name
ZDHHC8, DHHC8, ZDHHCL1, ZNF378
Definition
(RefSeq) zinc finger DHHC-type palmitoyltransferase 8
  KO
K20030  palmitoyltransferase ZDHHC5/8 [EC:2.3.1.225]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    29801 (ZDHHC8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     29801 (ZDHHC8)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Others
   GRIP associated proteins
    29801 (ZDHHC8)
SSDB
Motif
Pfam: DHHC
Other DBs
NCBI-GeneID: 29801
NCBI-ProteinID: NP_037505
OMIM: 608784
HGNC: 18474
Ensembl: ENSG00000099904
Vega: OTTHUMG00000150499
Pharos: Q9ULC8(Tbio)
UniProt: Q9ULC8
LinkDB
Position
22q11.21
AA seq 765 aa
MPRSPGTRLKPAKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFLFVLA
NFSMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHC
SVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVVAFGLVYVLNHAEGLGA
AHTTITMAVMCVAGLFFIPVIGLTGFHVVLVTRGRTTNEQVTGKFRGGVNPFTRGCCGNV
EHVLCSPLAPRYVVEPPRLPLAVSLKPPFLRPELLDRAAPLKVKLSDNGLKAGLGRSKSK
GSLDRLDEKPLDLGPPLPPKIEAGTFSSDLQTPRPGSAESALSVQRTSPPTPAMYKFRPA
FPTGPKVPFCGPGEQVPGPDSLTLGDDSIRSLDFVSEPSLDLPDYGPGGLHAAYPPSPPL
SASDAFSGALRSLSLKASSRRGGDHVALQPLRSEGGPPTPHRSIFAPHALPNRNGSLSYD
SLLNPGSPGGHACPAHPAVGVAGYHSPYLHPGATGDPPRPLPRSFSPVLGPRPREPSPVR
YDNLSRTIMASIQERKDREERERLLRSQADSLFGDSGVYDAPSSYSLQQASVLSEGPRGP
ALRYGSRDDLVAGPGFGGARNPALQTSLSSLSSSVSRAPRTSSSSLQADQASSNAPGPRP
SSGSHRSPARQGLPSPPGTPHSPSYAGPKAVAFIHTDLPEPPPSLTVQRDHPQLKTPPSK
LNGQSPGLARLGPATGPPGPSASPTRHTLVKKVSGVGGTTYEISV
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgccccgcagccccgggacgcgcctcaaacccgccaagtacatcccggtggccacggcc
gccgcgctgctggtcggctccagcaccctcttcttcgtgttcacgtgcccgtggttgaca
cgagctgtgtccccagctgttcccgtctacaatggcatcatcttcctctttgtcctggcc
aacttcagcatggccactttcatggaccctggtgttttcccccgagcggatgaggatgag
gacaaggaggacgacttccgggctccgctgtacaagaacgtggatgtgcgaggtatccag
gtccgcatgaagtggtgtgccacgtgccacttctaccgcccgccgcgctgctcccactgc
agcgtctgtgacaactgtgtagaggactttgaccaccactgcccctgggtcaacaactgc
atcgggcgtcgaaactatcgctacttcttcctgttcctgctgtcactcagtgcacacatg
gtgggcgtcgtggccttcggcctggtctacgtgctgaaccacgctgaggggctgggagcc
gcgcacaccaccatcaccatggctgtcatgtgtgtggccggcctcttcttcatccctgtc
attggcctcactggcttccatgtggtgctggtcactcgggggcgcaccaccaacgagcag
gtgactgggaagttccgcgggggtgtgaaccctttcacccgaggctgctgtgggaatgtg
gagcacgtgctgtgtagccccctggcgccccggtacgtggtggagccaccccggctgccg
ctcgcggtgagtttgaagccgcctttccttaggcctgaactcctggaccgagctgcaccg
ctcaaggtcaagcttagtgacaacgggctgaaggctggcctgggccgtagcaagtccaag
ggcagcctggaccggctggatgagaagccactggacttggggccaccactgccccccaag
atagaggctggcacgttcagcagtgacctgcagaccccgcgcccaggcagtgctgagagt
gccctgtcggtgcagaggaccagccccccgacacctgccatgtacaagtttaggccggct
ttccccacgggtcccaaggtgcccttctgtggaccaggcgagcaggttccaggccctgat
tccctgaccctgggggacgacagcatccgtagcctggactttgtgtccgagccgagcctg
gacctccctgactatgggccagggggcctgcatgcagcctacccgccatccccaccgctc
agcgcctctgatgccttctcgggcgctttgcgctccctgagcctcaaggcctcgagccgg
cggggcggggatcatgtggccctgcagcccctgcgctctgagggggggccccccacgccc
caccgtagcatttttgccccccatgcactgcccaaccgcaacggcagcctgtcctatgac
agcctgctcaatcctggctcgcctggtggccacgcctgccctgcccacccagcagttggc
gtggccggataccactcaccctacctgcatcctggggcaacgggcgacccgccacggccc
ctaccccgcagcttcagccccgtgctgggcccccgcccccgggagccctcgcctgtgcgc
tacgacaacctgtccaggaccatcatggcatccatccaggagcgcaaggacagggaggag
cgtgagcgcctgctgcgctcccaggccgactcactcttcggcgactcaggcgtctatgac
gctcccagctcctacagcctgcagcaggccagtgtgctgtccgagggcccccgaggtccc
gcgctgcgctatggctccagagacgaccttgtggctgggcccggcttcggtggcgcccgc
aaccctgccctgcagacgtcactgtcctcgctgtccagctccgtgagccgtgcaccgcgg
acgtcgtcctcctccctgcaggctgatcaggccagcagcaacgccccggggccccggccc
agcagtggctcacacaggtcacctgcacgccagggcctgccctccccgcccggcactccc
cactcaccatcctacgcgggccccaaagctgtcgccttcatccacacggacctcccagag
ccaccgccctcgctgaccgtgcagagggaccaccctcagctgaagactcccccaagtaag
cttaatgggcagtccccgggcctggcccggctgggacctgccaccggccccccagggccc
tctgccagccctacacggcacacgctggttaagaaggtgtccggcgtgggtgggaccacc
tacgagatctcggtgtga

DBGET integrated database retrieval system