KEGG   Homo sapiens (human): 2984
Entry
2984              CDS       T01001                                 

Gene name
GUCY2C, DIAR6, GC-C, GUC2C, MECIL, MUCIL, STAR
Definition
(RefSeq) guanylate cyclase 2C
  KO
K12320  heat-stable enterotoxin receptor [EC:4.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
Disease
H01174  Congenital diarrhea
H01615  Irritable bowel syndrome
Drug target
Dolcanatide: D11233
Linaclotide (DG00079): D06612 D09355<JP/US>
Plecanatide: D09948<US>
Recanaclotide: D10976
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    2984 (GUCY2C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2984 (GUCY2C)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     2984 (GUCY2C)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   2984 (GUCY2C)
SSDB
Motif
Pfam: Guanylate_cyc PK_Tyr_Ser-Thr Pkinase ANF_receptor LapA_dom
Other DBs
NCBI-GeneID: 2984
NCBI-ProteinID: NP_004954
OMIM: 601330
HGNC: 4688
Ensembl: ENSG00000070019
Vega: OTTHUMG00000168732
Pharos: P25092(Tclin)
UniProt: P25092
LinkDB
Position
12p12.3
AA seq 1073 aa
MKTLLLDLALWSLLFQPGWLSFSSQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNE
GLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLI
GPSCTYSTFQMYLDTELSYPMISAGSFGLSCDYKETLTRLMSPARKLMYFLVNFWKTNDL
PFKTYSWSTSYVYKNGTETEDCFWYLNALEASVSYFSHELGFKVVLRQDKEFQDILMDHN
RKSNVIIMCGGPEFLYKLKGDRAVAEDIVIILVDLFNDQYFEDNVTAPDYMKNVLVLTLS
PGNSLLNSSFSRNLSPTKRDFALAYLNGILLFGHMLKIFLENGENITTPKFAHAFRNLTF
EGYDGPVTLDDWGDVDSTMVLLYTSVDTKKYKVLLTYDTHVNKTYPVDMSPTFTWKNSKL
PNDITGRGPQILMIAVFTLTGAVVLLLLVALLMLRKYRKDYELRQKKWSHIPPENIFPLE
TNETNHVSLKIDDDKRRDTIQRLRQCKYDKKRVILKDLKHNDGNFTEKQKIELNKLLQID
YYNLTKFYGTVKLDTMIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKG
MSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKDLWTAPEHLRQANISQK
GDVYSYGIIAQEIILRKETFYTLSCRDRNEKIFRVENSNGMKPFRPDLFLETAEEKELEV
YLLVKNCWEEDPEKRPDFKKIETTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVE
ERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYS
TPMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEI
LSFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPL
RIHVSGSTIAILKRTECQFLYEVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQ
RLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTDKESTYF
NT seq 3222 nt   +upstreamnt  +downstreamnt
atgaagacgttgctgttggacttggctttgtggtcactgctcttccagcccgggtggctg
tcctttagttcccaggtgagtcagaactgccacaatggcagctatgaaatcagcgtcctg
atgatgggcaactcagcctttgcagagcccctgaaaaacttggaagatgcggtgaatgag
gggctggaaatagtgagaggacgtctgcaaaatgctggcctaaatgtgactgtgaacgct
actttcatgtattcggatggtctgattcataactcaggcgactgccggagtagcacctgt
gaaggcctcgacctactcaggaaaatttcaaatgcacaacggatgggctgtgtcctcata
gggccctcatgtacatactccaccttccagatgtaccttgacacagaattgagctacccc
atgatctcagctggaagttttggattgtcatgtgactataaagaaaccttaaccaggctg
atgtctccagctagaaagttgatgtacttcttggttaacttttggaaaaccaacgatctg
cccttcaaaacttattcctggagcacttcgtatgtttacaagaatggtacagaaactgag
gactgtttctggtaccttaatgctctggaggctagcgtttcctatttctcccacgaactc
ggctttaaggtggtgttaagacaagataaggagtttcaggatatcttaatggaccacaac
aggaaaagcaatgtgattattatgtgtggtggtccagagttcctctacaagctgaagggt
gaccgagcagtggctgaagacattgtcattattctagtggatcttttcaatgaccagtac
tttgaggacaatgtcacagcccctgactatatgaaaaatgtccttgttctgacgctgtct
cctgggaattcccttctaaatagctctttctccaggaatctatcaccaacaaaacgagac
tttgctcttgcctatttgaatggaatcctgctctttggacatatgctgaagatatttctt
gaaaatggagaaaatattaccacccccaaatttgctcatgctttcaggaatctcactttt
gaagggtatgacggtccagtgaccttggatgactggggggatgttgacagtaccatggtg
cttctgtatacctctgtggacaccaagaaatacaaggttcttttgacctatgatacccac
gtaaataagacctatcctgtggatatgagccccacattcacttggaagaactctaaactt
cctaatgatattacaggccggggccctcagatcctgatgattgcagtcttcaccctcact
ggagctgtggtgctgctcctgctcgtcgctctcctgatgctcagaaaatatagaaaagat
tatgaacttcgtcagaaaaaatggtcccacattcctcctgaaaatatctttcctctggag
accaatgagaccaatcatgttagcctcaagatcgatgatgacaaaagacgagatacaatc
cagagactacgacagtgcaaatacgacaaaaagcgagtgattctcaaagatctcaagcac
aatgatggtaatttcactgaaaaacagaagatagaattgaacaagttgcttcagattgac
tattacaacctgaccaagttctacggcacagtgaaacttgataccatgatcttcggggtg
atagaatactgtgagagaggatccctccgggaagttttaaatgacacaatttcctaccct
gatggcacattcatggattgggagtttaagatctctgtcttgtatgacattgctaaggga
atgtcatatctgcactccagtaagacagaagtccatggtcgtctgaaatctaccaactgc
gtagtggacagtagaatggtggtgaagatcactgattttggctgcaattccattttacct
ccaaaaaaggacctgtggacagctccagagcacctccgccaagccaacatctctcagaaa
ggagatgtgtacagctatgggatcatcgcacaggagatcatcctgcggaaagaaaccttc
tacactttgagctgtcgggaccggaatgagaagattttcagagtggaaaattccaatgga
atgaaacccttccgcccagatttattcttggaaacagcagaggaaaaagagctagaagtg
tacctacttgtaaaaaactgttgggaggaagatccagaaaagagaccagatttcaaaaaa
attgagactacacttgccaagatatttggactttttcatgaccaaaaaaatgaaagctat
atggataccttgatccgacgtctacagctatattctcgaaacctggaacatctggtagag
gaaaggacacagctgtacaaggcagagagggacagggctgacagacttaactttatgttg
cttccaaggctagtggtaaagtctctgaaggagaaaggctttgtggagccggaactatat
gaggaagttacaatctacttcagtgacattgtaggtttcactactatctgcaaatacagc
acccccatggaagtggtggacatgcttaatgacatctataagagttttgaccacattgtt
gatcatcatgatgtctacaaggtggaaaccatcggtgatgcgtacatggtggctagtggt
ttgcctaagagaaatggcaatcggcatgcaatagacattgccaagatggccttggaaatc
ctcagcttcatggggacctttgagctggagcatcttcctggcctcccaatatggattcgc
attggagttcactctggtccctgtgctgctggagttgtgggaatcaagatgcctcgttat
tgtctatttggagatacggtcaacacagcctctaggatggaatccactggcctccctttg
agaattcacgtgagtggctccaccatagccatcctgaagagaactgagtgccagttcctt
tatgaagtgagaggagaaacatacttaaagggaagaggaaatgagactacctactggctg
actgggatgaaggaccagaaattcaacctgccaacccctcctactgtggagaatcaacag
cgtttgcaagcagaattttcagacatgattgccaactctttacagaaaagacaggcagca
gggataagaagccaaaaacccagacgggtagccagctataaaaaaggcactctggaatac
ttgcagctgaataccacagacaaggagagcacctatttttaa

DBGET integrated database retrieval system