KEGG   Homo sapiens (human): 29850
Entry
29850             CDS       T01001                                 

Gene name
TRPM5, LTRPC5, MTR1
Definition
(RefSeq) transient receptor potential cation channel subfamily M member 5
  KO
K04980  transient receptor potential cation channel subfamily M member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    29850 (TRPM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    29850 (TRPM5)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   29850 (TRPM5)
SSDB
Motif
Pfam: LSDAT_euk LSDAT_prok Ion_trans
Other DBs
NCBI-GeneID: 29850
NCBI-ProteinID: NP_055370
OMIM: 604600
HGNC: 14323
Ensembl: ENSG00000070985
Vega: OTTHUMG00000009896
Pharos: Q9NZQ8(Tbio)
UniProt: Q9NZQ8
LinkDB
Position
11p15.5
AA seq 1165 aa
MQDVQGPRPGSPGDAEDRRELGLHRGEVNFGGSGKKRGKFVRVPSGVAPSVLFDLLLAEW
HLPAPNLVVSLVGEEQPFAMKSWLRDVLRKGLVKAAQSTGAWILTSALRVGLARHVGQAV
RDHSLASTSTKVRVVAVGMASLGRVLHRRILEEAQEDFPVHYPEDDGGSQGPLCSLDSNL
SHFILVEPGPPGKGDGLTELRLRLEKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERI
SRAVEQAAPWLILVGSGGIADVLAALVNQPHLLVPKVAEKQFKEKFPSKHFSWEDIVRWT
KLLQNITSHQHLLTVYDFEQEGSEELDTVILKALVKACKSHSQEPQDYLDELKLAVAWDR
VDIAKSEIFNGDVEWKSCDLEEVMVDALVSNKPEFVRLFVDNGADVADFLTYGRLQELYR
SVSRKSLLFDLLQRKQEEARLTLAGLGTQQAREPPAGPPAFSLHEVSRVLKDFLQDACRG
FYQDGRPGDRRRAEKGPAKRPTGQKWLLDLNQKSENPWRDLFLWAVLQNRHEMATYFWAM
GQEGVAAALAACKILKEMSHLETEAEAARATREAKYERLALDLFSECYSNSEARAFALLV
RRNRCWSKTTCLHLATEADAKAFFAHDGVQAFLTRIWWGDMAAGTPILRLLGAFLCPALV
YTNLITFSEEAPLRTGLEDLQDLDSLDTEKSPLYGLQSRVEELVEAPRAQGDRGPRAVFL
LTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLLVDFRPPPQGPSGPEVTLYFWVFTLVL
EEIRQGFFTDEDTHLVKKFTLYVGDNWNKCDMVAIFLFIVGVTCRMLPSAFEAGRTVLAM
DFMVFTLRLIHIFAIHKQLGPKIIVVERMMKDVFFFLFFLSVWLVAYGVTTQALLHPHDG
RLEWIFRRVLYRPYLQIFGQIPLDEIDEARVNCSTHPLLLEDSPSCPSLYANWLVILLLV
TFLLVTNVLLMNLLIAMFSYTFQVVQGNADMFWKFQRYNLIVEYHERPALAPPFILLSHL
SLTLRRVFKKEAEHKREHLERDLPDPLDQKVVTWETVQKENFLSKMEKRRRDSEGEVLRK
TAHRVDFIAKYLGGLREQEKRIKCLESQINYCSVLVSSVADVLAQGGGPRSSQHCGEGSQ
LVAADHRGGLDGWEQPGAGQPPSDT
NT seq 3498 nt   +upstreamnt  +downstreamnt
atgcaggatgtccaaggcccccgtcccggaagccccggggatgctgaagaccggcgggag
ctgggcttgcacaggggcgaggtcaactttggagggtctgggaagaagcgaggcaagttt
gtacgggtgccgagcggagtggccccgtctgtgctctttgacctgctgcttgctgagtgg
cacctgccggcccccaacctggtggtgtccctggtgggtgaggagcagcctttcgccatg
aagtcctggctgcgggatgtgctgcgcaaggggctggtgaaggcggctcagagcacagga
gcctggatcctgaccagtgccctccgcgtgggcctggccaggcatgtcgggcaggccgtg
cgcgaccactcgctggccagcacgtccaccaaggtccgtgtggttgctgtcggcatggcc
tcgctgggccgcgtcctgcaccgccgcattctggaggaggcccaggaggattttcctgtc
cactaccctgaggatgacggcggcagccagggccccctctgttcactggacagcaacctc
tcccacttcatcctggtggagccaggccccccggggaagggcgatgggctgacggagctg
cggctgaggctggagaagcacatctcggagcagagggcgggctacgggggcactggcagc
atcgagatccctgtcctctgcttgctggtcaatggtgatcccaacaccttggagaggatc
tccagggccgtggagcaggctgccccgtggctgatcctggtaggctcggggggcatcgcc
gatgtgcttgctgccctagtgaaccagccccacctcctggtgcccaaggtggccgagaag
cagtttaaggagaagttccccagcaagcatttctcttgggaggacatcgtgcgctggacc
aagctgctgcagaacatcacctcacaccagcacctgctcaccgtgtatgacttcgagcag
gagggctccgaggagctggacacggtcatcctgaaggcgctggtgaaagcctgcaagagc
cacagccaggagcctcaggactatctggatgagctcaagctggccgtggcctgggaccgc
gtggacatcgccaagagtgagatcttcaatggggacgtggagtggaagtcctgtgacctg
gaggaggtgatggtggacgccctggtcagcaacaagcccgagtttgtgcgcctctttgtg
gacaacggcgcagacgtggccgacttcctgacgtatgggcggctgcaggagctctaccgc
tccgtgtcacgcaagagcctgctcttcgacctgctgcagcggaagcaggaggaggcccgg
ctgacgctggccggcctgggcacccagcaggcccgggagccacccgcggggccaccggcc
ttctccctgcacgaggtctcccgcgtactcaaggacttcctgcaggacgcctgccgaggc
ttctaccaggacggccggccaggggaccgcaggagggcggagaagggcccggccaagcgg
cccacgggccagaagtggctgctggacctgaaccagaagagcgagaacccctggcgggac
ctgttcctgtgggccgtgctgcagaaccgccacgagatggccacctacttctgggccatg
ggccaggaaggtgtggcagccgcactggccgcctgcaaaatcctcaaagagatgtcgcac
ctggagacggaggccgaggcggcccgagccacgcgcgaggcgaaatacgagcggctggcc
cttgacctcttctccgagtgctacagcaacagtgaggcccgcgccttcgccctgctggtg
cgccggaaccgctgctggagcaagaccacctgcctgcacctggccaccgaggctgacgcc
aaggccttctttgcccacgacggcgttcaggccttcctgaccaggatctggtggggggac
atggccgcaggcacgcccatcctgcggctgctaggagccttcctctgccccgccctcgtc
tataccaacctcatcaccttcagtgaggaagctcccctgaggacaggcctggaggacctg
caggacctggacagcctggacacggagaagagcccgctgtatggcctgcagagccgggtg
gaggagctggtggaggcgccgagggctcagggtgaccgaggcccacgtgctgtcttcctg
ctcacacgctggcggaaattctggggcgctcccgtgactgtgttcctggggaacgtggtc
atgtacttcgccttcctcttcctgttcacctacgtcctgctggtggacttcaggccgccc
ccccagggcccctcagggcccgaggtcaccctctacttctgggtctttacgctggtgctg
gaggaaatccggcagggcttcttcacagacgaggacacacacctggtgaagaagttcaca
ctgtatgtgggggacaactggaacaagtgtgacatggtggccatcttcctgttcatcgtg
ggtgtcacctgcaggatgctgccgtcggcgtttgaggctggccgcacagtcctcgccatg
gacttcatggtgttcacgctgcggctgatccatatctttgccatacacaagcagctgggc
cccaagatcatcgtggtagagcgcatgatgaaggacgtcttcttcttcctcttctttctg
agcgtgtggctcgtggcctacggtgtcaccacccaggcgctgctgcacccccatgacggc
cgcctggagtggatcttccgccgggtgctctaccggccctacctgcagatcttcggccag
atcccactggacgagattgatgaagcccgtgtgaactgctccacccacccactgctgctg
gaggactcaccatcctgccccagcctctatgccaactggctggtcatcctcctgctggtc
accttcctgttggtcaccaatgtgctgctcatgaacctgctcatcgccatgttcagctac
acgttccaggtggtgcagggcaacgcagacatgttctggaagttccagcgctacaacctg
attgtggagtaccacgagcgccccgccctggccccgcccttcatcctgctcagccacctg
agcctgacgctccgccgggtcttcaagaaggaggctgagcacaagcgggagcacctggag
agagacctgccagaccccctggaccagaaggtcgtcacctgggagacagtccagaaggag
aacttcctgagcaagatggagaagcggaggagggacagcgagggggaggtgctgcggaaa
accgcccacagagtggacttcattgccaagtacctcgggggtctgagagagcaagaaaag
cgcatcaagtgtctggagtcacagatcaactactgctcggtgctcgtgtcctccgtggct
gacgtgctggcccagggtggcggcccccggagctctcagcactgtggcgagggaagccag
ctggtggctgctgaccacagaggtggtttagatggctgggaacaacccggggctggccag
cctccctcggacacctga

DBGET integrated database retrieval system