KEGG   Homo sapiens (human): 29915Help
Entry
29915             CDS       T01001                                 

Gene name
HCFC2, HCF-2, HCF2
Definition
(RefSeq) host cell factor C2
  KO
K14966  host cell factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00588  HSV VP16 to Oct-1-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    29915 (HCFC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    29915 (HCFC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    29915 (HCFC2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    29915 (HCFC2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     29915 (HCFC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     29915 (HCFC2)
   HMT complexes
    COMPASS/SET1 complex
     29915 (HCFC2)
    MLL-HCF complex
     29915 (HCFC2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    29915 (HCFC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_5 Kelch_3 Kelch_1 Kelch_4 Kelch_6 Kelch_2 fn3
Motif
Other DBs
NCBI-GeneID: 29915
NCBI-ProteinID: NP_037452
OMIM: 607926
HGNC: 24972
Ensembl: ENSG00000111727
Vega: OTTHUMG00000170175
Pharos: Q9Y5Z7(Tbio)
UniProt: Q9Y5Z7
LinkDB All DBs
Position
12q23.3
AA seq 792 aa AA seqDB search
MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTATNQWF
LPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPHPPPS
GLPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIP
VTKGVVPSPRESHTAVIYCKKDSGSPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGT
VPLPRSLHTASVIGNKMYIFGGWVPHKGENTETSPHDCEWRCTSSFSYLNLDTTEWTTLV
SDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAP
SQVQLIKATTNSFHVKWDEVSTVEGYLLQLSTDLPYQAASSDSSAAPNMQGVRMDPHRQG
SNNIVPNSINDTINSTKTEQPATKETSMKNKPDFKALTDSNAILYPSLASNASNHNSHVV
DMLRKNEGPHTSANVGVLSSCLDVRTVIPETSVSSTVSSTQTMVTQQTIKTESSSTNGAV
VKDETSLTTFSTKSEVDETYALPATKISRVETHATATPFSKETPSNPVATVKAGERQWCD
VGIFKNNTALVSQFYLLPKGKQSISKVGNADVPDYSLLKKQDLVPGTGYRFRVAAINGCG
IGPFSKISEFKTCIPGFPGAPSAVRISKNVEGIHLSWEPPTSPSGNILEYSAYLAIRTAQ
IQDNPSQLVFMRIYCGLKTSCIVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQVR
WLQGNNKKAPLN
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcccagcctcctcaactggaggcgagtttcttccttcacggggccggtcccc
cgcgcccggcacggacaccgagcggtggccatccgggagctgatgatcatctttggaggg
ggaaatgagggcatcgcggatgagctgcacgtctacaacacggctacgaatcagtggttt
ctgccagctgttagaggagatatccctccaggctgtgctgcccatggatttgtctgtgat
ggtaccagaatattagtatttgggggaatggttgaatatggaagatacagcaatgagtta
tatgagttacaagcaagtcgttggttatggaaaaaagtgaaaccccatccccctccttct
ggtttacctccttgtcctcggcttggacatagcttctctttatatggtaacaaatgctat
ttgtttggtggcctggcaaacgaaagcgaagattcaaacaataatgttcccagatattta
aatgatttttatgagttggagctacagcatggctctggtgttgtgggttggagcattcca
gtgactaaaggggttgtgccttctccaagagaatcccacacagctgttatatattgcaaa
aaagattctggaagtcctaaaatgtatgtttttggtggaatgtgtggtgctcgcctggat
gacctatggcagcttgacttagaaactatgtcatggtcaaaaccagaaactaaagggaca
gtgccacttccacgaagccttcatacagccagtgttataggaaacaagatgtacattttt
ggtggatgggtcccacataagggggaaaatactgagacttcacctcatgattgtgaatgg
agatgtaccagttcattttcttacctaaatctggatacaacagagtggaccaccctagta
tcagattctcaggaagataaaaaaaattcaagaccaagaccaagagctggccactgtgct
gttgcaatcggcactcgattgtatttttggagtggaagagatggctacaaaaaagcactg
aatagtcaagtttgctgcaaggatctttggtatcttgatactgagaaaccaccggcacca
tctcaagtacagctgatcaaagccactaccaactcctttcatgtcaagtgggatgaagtg
tctacagttgagggctatcttttgcagttgagtacagacttgccataccaagctgcatca
tcagattcttcagcagcaccaaatatgcaaggagtcaggatggaccctcacagacaaggc
agtaataacatcgttcctaacagtatcaatgatacaataaacagcacaaaaactgaacag
ccagccacaaaagaaacttcaatgaaaaacaaaccagactttaaagcactgacggattct
aatgccattttatatccatctttggcatcaaatgcttctaatcataatagtcatgtggtg
gatatgctaaggaaaaatgaaggtcctcacacttcagcaaatgtaggtgttctaagtagt
tgcctggatgtaagaacagtaattcctgaaacatctgtatccagtactgtttccagcaca
caaactatggtaacccagcagaccattaaaactgaatcatccagtacaaatggggcagtt
gttaaagatgaaacttcactaacaacattcagtaccaaatctgaagttgatgaaacatat
gcactgcctgcaacgaagatcagccgtgtagagacacatgctacagcaacgccgttttct
aaagagactccttcaaatccagtggccacagtgaaagcgggagaacgacaatggtgtgat
gtgggaatttttaaaaataatacagctttggtgagccagttttatttgctgccaaaaggg
aagcaaagcatctcaaaggtaggaaatgcagatgtacctgactacagcttgcttaagaaa
caagatcttgttccaggcacaggatacagattcagggttgctgcaatcaatggttgtggg
ataggtcctttcagcaaaatcagtgaatttaaaacttgtattcctggttttcctggagct
ccttctgcagtcagaatttcaaagaatgttgaaggtatccacctttcctgggaacctcca
acctcaccttctggaaatattttggaatattcagcctacttggctatccgcacagcacag
atacaagataatccaagtcaacttgtgttcatgaggatttattgtggtcttaagacatca
tgtatagtaactgctgggcaacttgcaaatgcacatattgattatacatccaggcctgcc
attgtgttcaggatatcagcaaagaatgaaaagggatatggaccagctacacaagttcgg
tggcttcaaggtaacaataagaaagcacctttaaattga

KEGG   Homo sapiens (human): 3054Help
Entry
3054              CDS       T01001                                 

Gene name
HCFC1, CFF, HCF, HCF-1, HCF1, HFC1, MRX3, PPP1R89, VCAF
Definition
(RefSeq) host cell factor C1
  KO
K14966  host cell factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00588  HSV VP16 to Oct-1-mediated transcription
Disease
H00480  X-linked mental retardation
H02222  Methylmalonic acidemia and homocysteinemia, cblX type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    3054 (HCFC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    3054 (HCFC1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3054 (HCFC1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    3054 (HCFC1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     3054 (HCFC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     3054 (HCFC1)
   HMT complexes
    COMPASS/SET1 complex
     3054 (HCFC1)
    MLL-HCF complex
     3054 (HCFC1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    3054 (HCFC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_5 Kelch_3 Kelch_4 Kelch_1 Kelch_6 Kelch_2 fn3
Motif
Other DBs
NCBI-GeneID: 3054
NCBI-ProteinID: NP_005325
OMIM: 300019
HGNC: 4839
Ensembl: ENSG00000172534
Vega: OTTHUMG00000024222
Pharos: P51610(Tbio)
UniProt: P51610
LinkDB All DBs
Structure
PDB: 

Position
Xq28
AA seq 2035 aa AA seqDB search
MASAVSPANLPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELH
VYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEW
KRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRP
GSGVVAWDIPITYGVLPPPRESHTAVVYTEKDNKKSKLVIYGGMSGCRLGDLWTLDIDTL
TWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLN
LDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLE
TEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDIPATAATATSPTPNPVPSV
PANPPKSPAPAAAAPAVQPLTQVGITLLPQAAPAPPTTTTIQVLPTVPGSSISVPTAART
QGVPAVLKVTGPQATTGTPLVTMRPASQAGKAPVTVTSLPAGVRMVVPTQSAQGTVIGSS
PQMSGMAALAAAAAATQKIPPSSAPTVLSVPAGTTIVKTMAVTPGTTTLPATVKVASSPV
MVSNPATRMLKTAAAQVGTSVSSATNTSTRPIITVHKSGTVTVAQQAQVVTTVVGGVTKT
ITLVKSPISVPGGSALISNLGKVMSVVQTKPVQTSAVTGQASTGPVTQIIQTKGPLPAGT
ILKLVTSADGKPTTIITTTQASGAGTKPTILGISSVSPSTTKPGTTTIIKTIPMSAIITQ
AGATGVTSSPGIKSPITIITTKVMTSGTGAPAKIITAVPKIATGHGQQGVTQVVLKGAPG
QPGTILRTVPMGGVRLVTPVTVSAVKPAVTTLVVKGTTGVTTLGTVTGTVSTSLAGAGGH
STSASLATPITTLGTIATLSSQVINPTAITVSAAQTTLTAAGGLTTPTITMQPVSQPTQV
TLITAPSGVEAQPVHDLPVSILASPTTEQPTATVTIADSGQGDVQPGTVTLVCSNPPCET
HETGTTNTATTTVVANLGGHPQPTQVQFVCDRQEAAASLVTSTVGQQNGSVVRVCSNPPC
ETHETGTTNTATTATSNMAGQHGCSNPPCETHETGTTNTATTAMSSVGANHQRDARRACA
AGTPAVIRISVATGALEAAQGSKSQCQTRQTSATSTTMTVMATGAPCSAGPLLGPSMARE
PGGRSPAFVQLAPLSSKVRLSSPSIKDLPAGRHSHAVSTAAMTRSSVGAGEPRMAPVCES
LQGGSPSTTVTVTALEALLCPSATVTQVCSNPPCETHETGTTNTATTSNAGSAQRVCSNP
PCETHETGTTHTATTATSNGGTGQPEGGQQPPAGRPCETHQTTSTGTTMSVSVGALLPDA
TSSHRTVESGLEVAAAPSVTPQAGTALLAPFPTQRVCSNPPCETHETGTTHTATTVTSNM
SSNQDPPPAASDQGEVESTQGDSVNITSSSAITTTVSSTLTRAVTTVTQSTPVPGPSVPP
PEELQVSPGPRQQLPPRQLLQSASTALMGESAEVLSASQTPELPAAVDLSSTGEPSSGQE
SAGSAVVATVVVQPPPPTQSEVDQLSLPQELMAEAQAGTTTLMVTGLTPEELAVTAAAEA
AAQAAATEEAQALAIQAVLQAAQQAVMGTGEPMDTSEAAATVTQAELGHLSAEGQEGQAT
TIPIVLTQQELAALVQQQQLQEAQAQQQHHHLPTEALAPADSLNDPAIESNCLNELAGTV
PSTVALLPSTATESLAPSNTFVAPQPVVVASPAKLQAAATLTEVANGIESLGVKPDLPPP
PSKAPMKKENQWFDVGVIKGTNVMVTHYFLPPDDAVPSDDDLGTVPDYNQLKKQELQPGT
AYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKI
IEYSVYLAIQSSQAGGELKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAII
FRIAARNEKGYGPATQVRWLQETSKDSSGTKPANKRPMSSPEMKSAPKKSKADGQ
NT seq 6108 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggccgtgtcgcccgccaacttgccagcggtgcttctgcagccccgctggaag
cgagtggtgggctggtcgggtccggtgccacggccccgccacggccaccgcgccgtggcc
atcaaggagctcatcgtggtgtttggcggcggcaacgagggaatagtggacgaactgcac
gtgtacaacacggcaaccaaccagtggttcatcccagccgtgaggggggacattccccct
gggtgtgcagcctatggcttcgtgtgtgacgggactcgcctcctggtgtttggtgggatg
gtggagtatgggaaatacagcaatgacctctacgaactccaggcgagccggtgggagtgg
aagagactcaaagcaaagacgcccaaaaacgggccccctccgtgtcctcgactcgggcac
agcttctcccttgtgggcaacaaatgctacctgtttgggggtctggccaatgatagcgag
gacccaaagaacaacattccaaggtacctgaatgacttatatatcctggaattacggcca
ggctctggagtggtagcctgggacattcccatcacttacggggtcctaccaccaccccgg
gagtcacatactgccgtggtctacaccgaaaaagacaataagaagtccaagctggtgatc
tacggcgggatgagtggctgcaggctgggggacctgtggaccctagatattgacaccctg
acgtggaataagcccagtctcagcggggtggcgcctcttcctcgcagtctccactcggca
accaccatcggaaataaaatgtacgtgtttggtggctgggtgcctctcgtcatggatgac
gtcaaagtggccacacacgagaaggagtggaagtgtaccaacacgctggcttgtctcaac
ctggataccatggcctgggagaccatcctgatggatacactggaggacaacatcccccgt
gctcgggctggccactgcgcagtcgccatcaacacccgcctgtacatttggagtgggcgt
gacggctaccgcaaggcctggaacaaccaggtctgctgcaaggacctctggtacctagag
acagaaaagccaccacccccagcccgagtacaactggtacgcgccaacaccaactccctg
gaggtgagctggggggcagtggcaacagccgacagctaccttctccagctccagaaatat
gacattcctgccacggctgctactgccacctcccctacacccaatccggtcccatctgtg
cctgccaaccctcccaagagccctgccccagcagcagccgcacctgctgtgcagccgctg
acccaagtaggcatcacgctcctgccccaggctgcccccgcacccccgaccaccaccacc
atccaggtcttgccaacggtgcctggcagctccatttctgtgcccaccgcagccaggact
caaggtgtccctgctgttctcaaagtgaccggtcctcaggctacaacaggaactccattg
gtcaccatgcgacctgccagccaggctgggaaagcccctgtcaccgtgacctcccttccc
gccggagtgcggatggttgtgccaacacagagtgcccagggaacggtgattggcagtagc
ccacagatgagtgggatggccgcactggccgctgcggccgctgccacccagaagatcccc
ccttcctcggcacccacggtgctgagtgtcccagcgggtaccaccatcgtgaagaccatg
gctgtgacacctggcactaccaccctcccagccactgtgaaggtggcctcctcgccagtc
atggtgagcaaccctgccactcgcatgctgaagactgcagccgcccaggtggggacatcg
gtttcctccgccaccaacacgtctacccgccctatcatcacagtgcacaagtcaggcact
gtgacagtggcccagcaagcccaggtggtgaccacagttgtgggcggggtcaccaagacc
atcaccctggtgaagagccccatctctgtcccaggaggcagtgctctgatttccaatctg
ggcaaagtgatgtcggtggtccagaccaaaccagttcagacttcagcagtcacaggccag
gcgtccacgggtcctgtgactcagatcatccagaccaaagggcccctgccagcgggaaca
atcctgaagctggtgacctcagcagatggcaagcccaccaccatcatcactaccacgcag
gccagtggggcggggaccaagcccaccatcctgggcatcagcagcgtctcccccagtacc
accaagcccggcacgaccaccatcatcaaaaccatccccatgtcggccatcatcacccag
gcgggcgccacgggtgtgaccagcagtcctggcatcaagtcccccatcaccatcatcacc
accaaggtgatgacttcaggaactggagcacctgcgaaaatcatcactgctgtccccaaa
attgccactggccacgggcagcagggagtgacccaggtggtgcttaagggggccccggga
cagccaggcaccatcctccgcactgtgcccatggggggtgttcgcctggtcacacccgtc
accgtctccgccgtcaagccagccgtcaccacgttggttgtgaaaggcaccacaggtgtc
acgaccctaggcacagtgacaggcaccgtctccaccagccttgccggggcggggggccac
agcactagtgcttccctggccacgcccatcaccaccttgggcaccattgccaccctctca
agccaggtgatcaaccccactgccatcactgtgtcggccgcacagaccacgctgacagcg
gcaggcgggctcacaaccccaaccatcaccatgcagcccgtgtcccagcccacccaggta
actctgatcacggcacctagtggggtggaggcccagcctgtgcatgacctccctgtgtcc
attctggcctccccgactacagaacagcccaccgccacagttaccatcgccgactcaggc
cagggtgatgtgcagcctggcactgtcaccttggtgtgctccaacccaccctgtgagacc
cacgagactggcaccaccaacacggccaccactactgttgtggctaaccttgggggacac
ccccagcccacccaagtgcagttcgtctgtgacagacaggaggcagctgcttctcttgtg
acctcgactgtgggccagcagaatggtagcgtggtccgagtctgttcgaacccgccctgc
gagacccacgagacgggcaccaccaacaccgccaccaccgccacctccaacatggccggg
cagcatggctgctcaaacccaccctgcgagacccacgagacgggcaccaccaacactgcc
actacagccatgtcgagcgtcggcgccaaccaccagcgagatgcccgtcgggcctgtgca
gctggcacccctgccgtgatccggatcagtgtggccactggggcgctggaggcagcccag
ggctctaagtcccagtgccaaacccgccagaccagcgcgaccagcaccaccatgactgtg
atggccaccggggccccgtgctcggccggcccactccttgggccgagcatggcacgggag
cccgggggccgcagccctgcttttgtgcagttggcccctctgagcagcaaagtcaggctg
agcagcccaagcattaaggaccttcctgcggggcgccacagccatgcggtcagcaccgct
gccatgacccgttccagcgtgggtgctggggagccccgcatggcacctgtgtgcgagagc
ctccagggtggctcgcccagcaccacagtgactgtgacagccctggaggcactgctgtgc
ccctcggccaccgtgacccaagtctgctccaacccaccatgtgagacccacgagacaggc
accaccaacaccgccactacctcgaatgcaggcagcgcccagagggtgtgctccaacccg
ccatgcgagacccacgagacgggcaccacccacacggccaccaccgctacttcaaacggg
ggcacgggccagcccgagggtgggcagcagccccctgctggtcgcccctgtgagacacac
cagaccacttccactggcaccaccatgtcggtcagcgtgggtgccctgcttcccgacgcc
acttcttcccacaggaccgtggagtctggcctagaggtggcggcggcacccagcgtcacc
ccccaggctggcaccgcgctgctggctcctttcccaacacagagggtgtgctccaacccc
ccctgtgagacccacgagacgggcaccactcacacggccaccactgtcacttccaacatg
agttcaaaccaagaccccccacctgctgccagcgatcagggagaggtggagagcacccag
ggcgacagcgtgaacatcaccagctccagtgccatcacgacaaccgtgtcctccacactg
acgcgggctgtgaccaccgtgacgcagtccacaccggtcccgggcccctctgtgccgccc
ccagaggaactccaggtgtcgccaggtcctcgccagcagctgccgccacggcagcttctg
cagtcggcttccacagccctgatgggggagtccgccgaggtcctgtcagcctcccagacc
cctgagctcccggccgccgtggatctgagcagcacaggggagccatcttcgggccaggag
tctgccggctctgcggtggtggccactgtggtggtccagccacccccacccacacagtcc
gaagtagaccagttatcacttccccaagagctaatggccgaggcccaagctggcaccacc
accctcatggtaacggggctcacccccgaggagctggcagtgacggctgctgcagaagca
gctgcccaggccgcagccacggaggaagcccaggccctggccatccaggcggtgctccag
gccgcgcagcaggccgtcatgggcaccggcgagcccatggacacctccgaggcagcagca
accgtgactcaggcggagctggggcacctgtcggccgagggtcaggagggccaggccacc
accatacccattgtgctgacacagcaggagctggctgccctggtgcagcagcagcagctg
caggaggcccaggcccagcagcagcatcaccacctccccactgaggccctggcccctgcc
gacagtctcaacgacccagccattgagagcaattgcctcaatgagctggccggcacggtc
cccagcactgtggcgctgctgccctcaacggccactgagagcctggctccatccaacaca
tttgtggccccccagccggttgtggtggccagcccagccaagctgcaggctgcagctacc
ctgaccgaagtggccaatggcatcgagtccctgggtgtgaagccagacctgccgccccca
cccagcaaagcccccatgaagaaggaaaaccagtggtttgatgtgggagtcattaagggc
accaatgtaatggtgacacactatttcctgccaccagatgatgctgtcccatcagacgat
gatttgggcaccgtccctgactataaccagctgaagaagcaggagctgcagccaggcaca
gcctataagtttcgtgttgccggaatcaatgcctgtggccgggggcccttcagcgaaatc
tcagcctttaagacgtgcctgcctggtttcccaggggccccttgtgccattaaaatcagc
aaaagtccggatggtgctcacctcacctgggagccaccctctgtgacctccggcaagatt
atcgagtactccgtgtacctggccatccagagctcacaggctgggggcgagctcaagagc
tccaccccggcccagctggccttcatgcgggtgtactgcgggcccagcccctcctgcctg
gtgcagtcctccagcctttccaacgcccacatcgactacaccaccaagcccgccatcatc
ttccgcatcgccgcccgcaatgagaagggctatggcccggccacacaagtgaggtggctg
caggaaaccagtaaagacagctctggcaccaagccagccaacaagcggcccatgtcctct
ccagaaatgaaatctgctccaaagaaatctaaggccgatggtcagtga

DBGET integrated database retrieval system