KEGG   Homo sapiens (human): 2993Help
Entry
2993              CDS       T01001                                 

Gene name
GYPA, CD235a, GPA, GPErik, GPSAT, HGpMiV, HGpMiXI, HGpSta(C), MN, MNS, PAS-2
Definition
(RefSeq) glycophorin A (MNS blood group)
  KO
K06575  glycophorin A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
hsa05144  Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2993 (GYPA)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    2993 (GYPA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2993 (GYPA)
CD molecules [BR:hsa04090]
 Proteins
  2993 (GYPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycophorin_A Collectrin
Motif
Other DBs
NCBI-GeneID: 2993
NCBI-ProteinID: NP_002090
OMIM: 617922
HGNC: 4702
Ensembl: ENSG00000170180
Vega: OTTHUMG00000161403
Pharos: P02724(Tbio)
UniProt: P02724 A0A0C4DFT7
LinkDB All DBs
Structure
PDB: 

Position
4q31.21
AA seq 150 aa AA seqDB search
MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAH
EVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK
SPSDVKPLPSPDTDVPLSSVEIENPETSDQ
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaaaaataatctttgtattactattgtcagaaattgtgagcatatcagcatta
agtaccactgaggtggcaatgcacacttcaacttcttcttcagtcacaaagagttacatc
tcatcacagacaaatgatacgcacaaacgggacacatatgcagccactcctagagctcat
gaagtttcagaaatttctgttagaactgtttaccctccagaagaggaaaccggagaaagg
gtacaacttgcccatcatttctctgaaccagagataacactcattatttttggggtgatg
gctggtgttattggaacgatcctcttaatttcttacggtattcgccgactgataaagaaa
agcccatctgatgtaaaacctctcccctcacctgacacagacgtgcctttaagttctgtt
gaaatagaaaatccagagacaagtgatcaatga

DBGET integrated database retrieval system