KEGG   Homo sapiens (human): 29941Help
Entry
29941             CDS       T01001                                 

Gene name
PKN3, UTDP4-1
Definition
(RefSeq) protein kinase N3
  KO
K06071  protein kinase N [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa05132  Salmonella infection
hsa05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    29941 (PKN3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    29941 (PKN3)
   05135 Yersinia infection
    29941 (PKN3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    29941 (PKN3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     29941 (PKN3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKN family
   29941 (PKN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase HR1 Pkinase_Tyr Kinase-like Pkinase_C
Motif
Other DBs
NCBI-GeneID: 29941
NCBI-ProteinID: NP_037487
OMIM: 610714
HGNC: 17999
Ensembl: ENSG00000160447
Vega: OTTHUMG00000020757
Pharos: Q6P5Z2(Tbio)
UniProt: Q6P5Z2 A0A024R8D6
LinkDB All DBs
Position
9q34.11
AA seq 889 aa AA seqDB search
MEEGAPRQPGPSQWPPEDEKEVIRRAIQKELKIKEGVENLRRVATDRRHLGHVQQLLRSS
NRRLEQLHGELRELHARILLPGPGPGPAEPVASGPRPWAEQLRARHLEALRRQLHVELKV
KQGAENMTHTCASGTPKERKLLAAAQQMLRDSQLKVALLRMKISSLEASGSPEPGPELLA
EELQHRLHVEAAVAEGAKNVVKLLSSRRTQDRKALAEAQAQLQESSQKLDLLRLALEQLL
EQLPPAHPLRSRVTRELRAAVPGYPQPSGTPVKPTALTGTLQVRLLGCEQLLTAVPGRSP
AAALASSPSEGWLRTKAKHQRGRGELASEVLAVLKVDNRVVGQTGWGQVAEQSWDQTFVI
PLERARELEIGVHWRDWRQLCGVAFLRLEDFLDNACHQLSLSLVPQGLLFAQVTFCDPVI
ERRPRLQRQERIFSKRRGQDFLRASQMNLGMAAWGRLVMNLLPPCSSPSTISPPKGCPRT
PTTLREASDPATPSNFLPKKTPLGEEMTPPPKPPRLYLPQEPTSEETPRTKRPHMEPRTR
RGPSPPASPTRKPPRLQDFRCLAVLGRGHFGKVLLVQFKGTGKYYAIKALKKQEVLSRDE
IESLYCEKRILEAVGCTGHPFLLSLLACFQTSSHACFVTEFVPGGDLMMQIHEDVFPEPQ
ARFYVACVVLGLQFLHEKKIIYRDLKLDNLLLDAQGFLKIADFGLCKEGIGFGDRTSTFC
GTPEFLAPEVLTQEAYTRAVDWWGLGVLLYEMLVGECPFPGDTEEEVFDCIVNMDAPYPG
FLSVQGLEFIQKLLQKCPEKRLGAGEQDAEEIKVQPFFRTTNWQALLARTIQPPFVPTLC
GPADLRYFEGEFTGLPPALTPPAPHSLLTARQQAAFRDFDFVSERFLEP
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggaggagggggcgccgcggcagcctgggccgagccagtggcccccagaggatgagaag
gaggtgatccgccgggccatccagaaagagctgaagatcaaggagggggtggagaacctg
cggcgcgtggccacagaccgccgccacttgggccatgtgcagcagctgctgcggtcctcc
aaccgccgcctggagcagctgcatggcgagctgcgggagctgcacgcccgaatcctgctg
cccggccctgggcctggcccagctgagcctgtggcctcaggaccccggccgtgggcagag
cagctcagggctcggcacctagaggctctccggaggcagctgcatgtggagctgaaggtg
aagcagggggctgagaacatgacccacacgtgcgccagtggcacccccaaggagaggaag
ctcctggcagctgcccagcagatgctgcgggacagccagctgaaggtggccctgctgcgg
atgaagatcagcagcctggaggccagtgggtccccggagccagggcctgagctgctggcg
gaggagctacagcatcgactgcacgttgaggcagctgtggctgagggcgccaagaacgtg
gtgaaactgcttagtagccggagaacacaggaccgcaaggcactggctgaggcccaggcc
cagctacaggagtcctctcagaaactggacctcctgcgcctggccttggagcagctgctg
gagcaactgcctcctgcccaccctttgcgcagcagagtgacccgagagttgcgggctgcg
gtgcctggatacccccagccttcagggacacctgtgaagcccaccgccctaacagggaca
ctgcaggtccgcctcctgggctgtgaacagttgctgacagccgtgcctgggcgctcccca
gcggccgcactggccagcagcccctccgagggctggcttcggaccaaggccaagcaccag
cgtggccgaggcgagcttgccagcgaggtgctggctgtgctaaaggtggacaaccgtgtt
gtggggcagacgggctgggggcaggtggccgaacagtcctgggaccagacctttgtcatc
ccactggagcgagcccgtgagctggagattggggtacactggcgggactggcggcagcta
tgtggcgtggccttcctgagacttgaggacttcctggacaatgcctgtcaccaactgtcc
ctcagcctggtaccgcagggactgctttttgcccaggtgaccttctgcgatcctgtcatt
gagaggcggccccggctgcagaggcaggaacgcatcttctctaaacgcagaggccaggac
ttcctgagggcttcgcagatgaacctcggcatggcggcctgggggcgcctcgtcatgaac
ctgctgcccccctgcagctccccgagcacaatcagcccccctaaaggatgccctcggacc
ccaacaacactgcgagaggcctctgaccctgccactcccagtaatttcctgcccaagaag
acccccttgggtgaagagatgacacccccacccaagcccccacgcctctacctcccccag
gagccaacatccgaggagactccgcgcaccaaacgtccccatatggagcctaggactcga
cgtgggccatctccaccagcctcccccaccaggaaaccccctcggcttcaggacttccgc
tgcttagctgtgctgggccggggacactttgggaaggtcctcctggtccagttcaagggg
acagggaaatactacgccatcaaagcactgaagaagcaggaggtgctcagccgggacgag
atagagagcctgtactgcgagaagcggatcctggaggctgtgggctgcacagggcaccct
ttcctgctctccctccttgcctgcttccagacctccagccatgcctgctttgtgactgag
tttgtgcctggtggtgacctcatgatgcagatccacgaggatgtcttccccgagccccag
gcccgcttctacgtggcttgtgttgtcctggggctgcagttcttacacgagaagaagatc
atttacagggacctgaagttggataaccttctgctggatgcccagggattcctgaagatc
gcagactttggactctgcaaggaagggatcggcttcggggaccggactagcaccttctgt
ggcaccccggagttcctggctcccgaggtgctgacccaggaggcatacacacgggctgtg
gactggtgggggctgggtgtgctgctctacgagatgctggtgggtgagtgcccgttccca
ggggacacagaggaagaggtgtttgactgcatcgtcaacatggacgccccctaccccggc
tttctgtcggtgcaagggcttgagttcattcagaagctcctccagaagtgcccggagaag
cgcctcggggcaggtgagcaggatgccgaggagatcaaggtccagccattcttcaggacc
accaactggcaagccctgctcgcccgcaccatccagccccccttcgtgcctaccctgtgt
ggccctgcggacctgcgctactttgagggcgagttcacagggctgccgcctgccctgacc
ccacctgcaccccacagcctcctcactgcccgccaacaggccgccttccgggacttcgac
tttgtgtcagagcgattcctggaaccctga

DBGET integrated database retrieval system