KEGG   Homo sapiens (human): 2997Help
Entry
2997              CDS       T01001                                 

Gene name
GYS1, GSY, GYS
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04910  Insulin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
Disease
H00069  Glycogen storage disease
H01762  Muscle glycogen storage disease
H01949  Glycogen storage disease type 0b
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    2997 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    2997 (GYS1)
   04152 AMPK signaling pathway
    2997 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    2997 (GYS1)
   04922 Glucagon signaling pathway
    2997 (GYS1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    2997 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    2997 (GYS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     2997 (GYS1)
Glycosyltransferases [BR:hsa01003]
 Polysaccharide
  Storage polysaccharide
   2997 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 2997
NCBI-ProteinID: NP_002094
OMIM: 138570
HGNC: 4706
Ensembl: ENSG00000104812
Vega: OTTHUMG00000150723
Pharos: P13807(Tchem)
UniProt: P13807
LinkDB All DBs
Position
19q13.33
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLS
TPSEPLSPTSSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaaccgcactttgtccatgtcctcactgccaggactggaggactgggaggat
gaattcgacctggagaacgcagtgctcttcgaagtggcctgggaggtggctaacaaggtg
ggtggcatctacacggtgctgcagacgaaggcgaaggtgacaggggacgaatggggcgac
aactacttcctggtggggccgtacacggagcagggcgtgaggacccaggtggaactgctg
gaggcccccaccccggccctgaagaggacactggattccatgaacagcaagggctgcaag
gtgtatttcgggcgctggctgatcgagggaggccctctggtggtgctcctggacgtgggt
gcctcagcttgggccctggagcgctggaagggagagctctgggatacctgcaacatcgga
gtgccgtggtacgaccgcgaggccaacgacgctgtcctctttggctttctgaccacctgg
ttcctgggtgagttcctggcacagagtgaggagaagccacatgtggttgctcacttccat
gagtggttggcaggcgttggactctgcctgtgtcgtgcccggcgactgcctgtagcaacc
atcttcaccacccatgccacgctgctggggcgctacctgtgtgccggtgccgtggacttc
tacaacaacctggagaacttcaacgtggacaaggaagcaggggagaggcagatctaccac
cgatactgcatggaaagggcggcagcccactgcgctcacgtcttcactactgtgtcccag
atcaccgccatcgaggcacagcacttgctcaagaggaaaccagatattgtgacccccaat
gggctgaatgtgaagaagttttctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcatctggacttcaacttg
gacaagaccttatacttctttatcgccggccgctatgagttctccaacaagggtgctgac
gtcttcctggaggcattggctcggctcaactatctgctcagagtgaacggcagcgagcag
acagtggttgccttcttcatcatgccagcgcggaccaacaatttcaacgtggaaaccctc
aaaggccaagctgtgcgcaaacagctttgggacacggccaacacggtgaaggaaaagttc
gggaggaagctttatgaatccttactggttgggagccttcccgacatgaacaagatgctg
gataaggaagacttcactatgatgaagagagccatctttgcaacgcagcggcagtctttc
ccccctgtgtgcacccacaatatgctggatgactcctcagaccccatcctgaccaccatc
cgccgaatcggcctcttcaatagcagtgccgacagggtgaaggtgattttccacccggag
ttcctctcctccacaagccccctgctccctgtggactatgaggagtttgtccgtggctgt
caccttggagtcttcccctcctactatgagccttggggctacacaccggctgagtgcacg
gttatgggaatccccagtatctccaccaatctctccggcttcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggtatctacattcttgaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagtttctgtcagcagagccggcgg
cagcgtatcatccagcggaaccgcacggagcgcctctccgaccttctggactggaaatac
ctaggccggtactatatgtctgcgcgccacatggcgctgtccaaggcctttccagagcac
ttcacctacgagcccaacgaggcggatgcggcccaggggtaccgctacccacggccagcc
tcggtgccaccgtcgccctcgctgtcacgacactccagcccgcaccagagtgaggacgag
gaggatccccggaacgggccgctggaggaagacggcgagcgctacgatgaggacgaggag
gccgccaaggaccggcgcaacatccgtgcaccagagtggccgcgccgagcgtcctgcacc
tcctccaccagcggcagcaagcgcaactctgtggacacggccacctccagctcactcagc
accccgagcgagcccctcagccccaccagctccctgggcgaggagcgtaactaa

DBGET integrated database retrieval system