KEGG   Homo sapiens (human): 29982
Entry
29982             CDS       T01001                                 

Gene name
NRBF2, COPR, COPR1, COPR2, NRBF-2
Definition
(RefSeq) nuclear receptor binding factor 2
  KO
K21246  nuclear receptor-binding factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    29982 (NRBF2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29982 (NRBF2)
   05014 Amyotrophic lateral sclerosis
    29982 (NRBF2)
   05016 Huntington disease
    29982 (NRBF2)
   05017 Spinocerebellar ataxia
    29982 (NRBF2)
   05022 Pathways of neurodegeneration - multiple diseases
    29982 (NRBF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    29982 (NRBF2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    29982 (NRBF2)
SSDB
Motif
Pfam: NRBF2 NRBF2_MIT MIT YabA bZIP_1 DivIC HALZ ZapB DUF5101
Other DBs
NCBI-GeneID: 29982
NCBI-ProteinID: NP_110386
OMIM: 616477
HGNC: 19692
Ensembl: ENSG00000148572
Vega: OTTHUMG00000018309
Pharos: Q96F24(Tbio)
UniProt: Q96F24
LinkDB
Structure
PDB: 
4ZEY

Position
10q21.3
AA seq 287 aa
MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQ
RDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYS
PSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKR
HVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATAS
STWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN
NT seq 864 nt   +upstreamnt  +downstreamnt
atggaagtaatggaaggacccctcaacctggctcatcaacagagcagacgagcagaccgt
ttattagctgcaggcaaatacgaagaggctatttcttgtcacaaaaaggctgcagcatat
ctttctgaagccatgaagctgacacagtcagagcaggctcatctttcactggaattgcaa
agggatagccatatgaaacagctcctcctcatccaagagagatggaaaagggcccagcgt
gaagaaagattgaaagcccagcagaacacagacaaggatgcagctgcccatcttcagaca
tctcacaaaccctctgcagaggatgcagagggccagagtcccctttctcagaagtacagc
ccttccacagagaaatgcctgcctgagattcaggggatctttgacagggatccagacaca
ctactttatttacttcagcaaaagagtgagccagcagagccatgtattggaagcaaagcc
ccaaaagatgataaaacaattatagaggagcaggcaaccaaaattgcagatttgaagagg
catgtggaattccttgtggctgagaatgaaagattaaggaaagaaaataaacaactaaag
gctgaaaaggccagacttctaaaaggtccaatagaaaaggagctggatgtagatgctgat
tttgtagaaacgtcagagttatggagcttgccaccacatgcagaaactgctacagcctcc
tcaacctggcagaagttcgcagcaaatactgggaaagccaaggacattccaatccccaat
cttcctcccttggattttccatctccagaacttcctcttatggagctctctgaggatatt
ctgaaaggatttatgaataattaa

DBGET integrated database retrieval system