KEGG   Homo sapiens (human): 29984Help
Entry
29984             CDS       T01001                                 

Gene name
RHOD, ARHD, RHOHP1, RHOM, Rho
Definition
(RefSeq) ras homolog family member D
  KO
K07530  Ras homolog gene family, member D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    29984 (RHOD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    29984 (RHOD)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rho Family
   Others
    29984 (RHOD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA ABC_tran AAA_5 AAA_16 PduV-EutP NACHT TniB AAA_25 Htr2 AAA_21 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 29984
NCBI-ProteinID: NP_055393
OMIM: 605781
HGNC: 670
Ensembl: ENSG00000173156
Vega: OTTHUMG00000167102
Pharos: O00212(Tbio)
UniProt: O00212
LinkDB All DBs
Structure
PDB: 

Position
11q13.2
AA seq 210 aa AA seqDB search
MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQV
KGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCK
KVPIIVVGCKTDLRKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVH
AVFQEAAEVALSSRGRNFWRRITQGFCVVT
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggcccaggccgcgggtgaggaggcgccaccaggcgtgcggtccgtcaaggtg
gtcctggtgggcgacggcggctgcgggaagacgtcgctgctgatggtcttcgccgatggg
gccttccccgagagctacacccccacggtgtttgagcggtacatggtcaacctgcaagtg
aaaggcaaacctgtgcacctccacatctgggacacagcagggcaagatgactatgaccgc
ctgcggcccctgttctaccctgacgccagcgtcctgctgctttgcttcgatgtcaccagc
ccgaacagctttgacaacatctttaaccggtggtacccagaagtgaatcatttctgcaag
aaggtacccatcatcgtcgtgggctgcaagactgacctgcgcaaggacaaatcactggtg
aacaagctccgaagaaacggattggagcctgtgacctaccacaggggccaggagatggcg
aggtccgtgggcgcggtggcctacctcgagtgctcggctcggctccatgacaacgtccac
gccgtcttccaggaggccgccgaggtggccctcagcagccgcggtcgcaacttctggcgg
cggattacccagggcttttgcgtggtgacctga

DBGET integrated database retrieval system