KEGG   Homo sapiens (human): 29992Help
Entry
29992             CDS       T01001                                 

Gene name
PILRA, FDF03
Definition
(RefSeq) paired immunoglobin like type 2 receptor alpha
  KO
K15411  paired immunoglobulin-like type 2 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    29992 (PILRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set SKG6 SCIMP MLANA I-set SIT Ig_3 RCR Herpes_gE RIFIN DUF3306 EphA2_TM
Motif
Other DBs
NCBI-GeneID: 29992
NCBI-ProteinID: NP_038467
OMIM: 605341
HGNC: 20396
Ensembl: ENSG00000085514
Vega: OTTHUMG00000155248
Pharos: Q9UKJ1(Tbio)
UniProt: Q9UKJ1
LinkDB All DBs
Structure
PDB: 

Position
7q22.1
AA seq 303 aa AA seqDB search
MGRPLLLPLLPLLLPPAFLQPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWE
LATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQ
SVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRV
TQGKRRSDSWHISLETAVGVAVAVTVLGIMILGLICLLRWRRRKGQQRTKATTPAREPFQ
NTEEPYENIRNEGQNTDPKLNPKDDGIVYASLALSSSTSPRAPPSHRPLKSPQNETLYSV
LKA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgggtcggcccctgctgctgcccctactgcccttgctgctgccgccagcatttctgcag
cctagtggctccacaggatctggtccaagctacctttatggggtcactcaaccaaaacac
ctctcagcctccatgggtggctctgtggaaatccccttctccttctattacccctgggag
ttagccacagctcccgacgtgagaatatcctggagacggggccacttccacaggcagtcc
ttctacagcacaaggccgccttccattcacaaggattatgtgaaccggctctttctgaac
tggacagagggtcagaagagcggcttcctcaggatctccaacctgcagaagcaggaccag
tctgtgtatttctgccgagttgagctggacacacggagctcagggaggcagcagtggcag
tccatcgaggggaccaaactctccatcacccaggctgtcacgaccaccacccagaggccc
agcagcatgactaccacctggaggctcagtagcacaaccaccacaaccggcctcagggtc
acacagggcaaacgacgctcagactcttggcacataagtctggagactgctgtgggggtg
gcagtggctgtcactgtgctcggaatcatgattttgggactgatctgcctcctcaggtgg
aggagaaggaaaggtcagcagcggactaaagccacaaccccagccagggaacccttccaa
aacacagaggagccatatgagaatatcaggaatgaaggacaaaatacagatcccaagcta
aatcccaaggatgacggcatcgtctatgcttcccttgccctctccagctccacctcaccc
agagcacctcccagccaccgtcccctcaagagcccccagaacgagaccctgtactctgtc
ttaaaggcctaa

DBGET integrated database retrieval system