KEGG   Homo sapiens (human): 30009
Entry
30009             CDS       T01001                                 

Gene name
TBX21, T-PET, T-bet, TBET, TBLYM
Definition
(RefSeq) T-box transcription factor 21
  KO
K10166  T-box protein 21
Organism
hsa  Homo sapiens (human)
Pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05321  Inflammatory bowel disease
Disease
H01191  Asthma with nasal polyps and aspirin intolerance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    30009 (TBX21)
   04659 Th17 cell differentiation
    30009 (TBX21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    30009 (TBX21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    30009 (TBX21)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   T-box
    30009 (TBX21)
SSDB
Motif
Pfam: T-box T-box_assoc
Other DBs
NCBI-GeneID: 30009
NCBI-ProteinID: NP_037483
OMIM: 604895
HGNC: 11599
Ensembl: ENSG00000073861
Vega: OTTHUMG00000178287
Pharos: Q9UL17(Tbio)
UniProt: Q9UL17
LinkDB
Position
17q21.32
AA seq 535 aa
MGIVEPGCGDMLTGTEPMPGSDEGRAPGADPQHRYFYPEPGAQDADERRGGGSLGSPYPG
GALVPAPPSRFLGAYAYPPRPQAAGFPGAGESFPPPADAEGYQPGEGYAAPDPRAGLYPG
PREDYALPAGLEVSGKLRVALNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPT
SHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFG
KLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEPEAACNASNTHIFTFQETQFI
AVTAYQNAEITQLKIDNNPFAKGFRENFESMYTSVDTSIPSPPGPNCQFLGGDHYSPLLP
NQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYY
RGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEI
APIRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgggcatcgtggagccgggttgcggagacatgctgacgggcaccgagccgatgccgggg
agcgacgagggccgggcgcctggcgccgacccgcagcaccgctacttctacccggagccg
ggcgcgcaggacgcggacgagcgtcgcgggggcggcagcctggggtctccctacccgggg
ggcgccttggtgcccgccccgccgagccgcttccttggagcctacgcctacccgccgcga
ccccaggcggccggcttccccggcgcgggcgagtccttcccgccgcccgcggacgccgag
ggctaccagccgggcgagggctacgccgccccggacccgcgcgccgggctctacccgggg
ccgcgtgaggactacgcgctacccgcgggactggaggtgtcggggaaactgagggtcgcg
ctcaacaaccacctgttgtggtccaagtttaatcagcaccagacagagatgatcatcacc
aagcagggacggcggatgttcccattcctgtcatttactgtggccgggctggagcccacc
agccactacaggatgtttgtggacgtggtcttggtggaccagcaccactggcggtaccag
agcggcaagtgggtgcagtgtggaaaggccgagggcagcatgccaggaaaccgcctgtac
gtccacccggactcccccaacacaggagcgcactggatgcgccaggaagtttcatttggg
aaactaaagctcacaaacaacaagggggcgtccaacaatgtgacccagatgattgtgctc
cagtccctccataagtaccagccccggctgcatatcgttgaggtgaacgacggagagcca
gaggcagcctgcaacgcttccaacacgcatatctttactttccaagaaacccagttcatt
gccgtgactgcctaccagaatgccgagattactcagctgaaaattgataataaccccttt
gccaaaggattccgggagaactttgagtccatgtacacatctgttgacaccagcatcccc
tccccgcctggacccaactgtcaattccttgggggagatcactactctcctctcctaccc
aaccagtatcctgttcccagccgcttctaccccgaccttcctggccaggcgaaggatgtg
gttccccaggcttactggctgggggccccccgggaccacagctatgaggctgagtttcga
gcagtcagcatgaagcctgcattcttgccctctgcccctgggcccaccatgtcctactac
cgaggccaggaggtcctggcacctggagctggctggcctgtggcaccccagtaccctccc
aagatgggcccggccagctggttccgccctatgcggactctgcccatggaacccggccct
ggaggctcagagggacggggaccagaggaccagggtccccccttggtgtggactgagatt
gcccccatccggccggaatccagtgattcaggactgggcgaaggagactctaagaggagg
cgcgtgtccccctatccttccagtggtgacagctcctcccctgctggggccccttctcct
tttgataaggaagctgaaggacagttttataactattttcccaactga

DBGET integrated database retrieval system