KEGG   Homo sapiens (human): 30012Help
Entry
30012             CDS       T01001                                 

Gene name
TLX3, HOX11L2, RNX
Definition
(RefSeq) T cell leukemia homeobox 3
  KO
K15607  T-cell leukemia homeobox protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Disease
H00002  T-cell acute lymphoblastic leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    30012 (TLX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    30012 (TLX3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, H2.0
    30012 (TLX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homez Pilt Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 30012
NCBI-ProteinID: NP_066305
OMIM: 604640
HGNC: 13532
Ensembl: ENSG00000164438
Vega: OTTHUMG00000163207
Pharos: O43711(Tbio)
UniProt: O43711
LinkDB All DBs
Position
5q35.1
AA seq 291 aa AA seqDB search
MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGATYPSLP
ASFAGLGAPFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSL
GGLNFPWMESSRRFVKDRFTAAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICE
LEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLM
LQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcccgccagcgcgcagaccccgcacccgcacgagcccatcagcttcggcatc
gaccagatccttaacagcccggaccaggacagcgcacccgccccgcggggccccgacggc
gccagctacctgggagggccccccgggggccgtccgggcgccacatacccgtctctgccc
gcctcctttgcgggcctcggcgcgcccttcgaggacgcgggatcttacagtgtgaacctg
agcctagcgcccgcaggcgtgatccgggtgccggcgcacaggccgctgcccggggccgtg
ccaccgcctctgccaagcgcgctacccgccatgccctccgtgcccacggtctccagcctt
ggcggtctcaatttcccctggatggagagcagccgccgcttcgtgaaagaccgcttcaca
gcggcggccgcactcacgcccttcaccgtgacccggcgcatcggccacccctaccagaac
cggacgccgcccaagcgtaagaagccgcgcacgtccttttcccgggtgcagatctgcgag
ctggaaaagcgcttccatcgccagaagtacctggcctctgccgagagggcggcgctcgcc
aagtccctcaaaatgacggacgcgcaggtcaagacctggttccaaaaccggaggaccaag
tggcggcggcagacggcggaggagcgggaggcggagcggcagcaggcgagccggctcatg
ctgcagctgcaacacgacgccttccaaaagagcctcaacgactccatccagcctgacccg
ctctgtctgcacaactcgtcactctttgctctgcagaatctgcagccctgggaggaggat
agttccaaggttcccgctgtcacctccctggtgtga

DBGET integrated database retrieval system