KEGG   Homo sapiens (human): 3020Help
Entry
3020              CDS       T01001                                 

Gene name
H3-3A, H3-3B, H3.3A, H3F3, H3F3A
Definition
(RefSeq) H3.3 histone A
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Disease
H01470  Giant cell tumor of bone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3020 (H3-3A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3020 (H3-3A)
  09165 Substance dependence
   05034 Alcoholism
    3020 (H3-3A)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    3020 (H3-3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3020 (H3-3A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3020 (H3-3A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3020 (H3-3A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3020 (H3-3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 3020
NCBI-ProteinID: NP_002098
OMIM: 601128
HGNC: 4764
Ensembl: ENSG00000163041
Vega: OTTHUMG00000037507
UniProt: P84243 A0A024R3S0 B2R4P9
LinkDB All DBs
Structure
PDB: 

Position
1q42.12
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcacccaggaagcaa
ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat
cgttacaggcctggtactgtggcgctccgtgaaattagacgttatcagaagtccactgaa
cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggactttaaa
acagatctgcgcttccagagcgcagctatcggtgctttgcaggaggcaagtgaggcctat
ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt
atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system