KEGG   Homo sapiens (human): 3047
Entry
3047              CDS       T01001                                 

Gene name
HBG1, HBG-T2, HBGA, HBGR, HSGGL1, PRO2979
Definition
(RefSeq) hemoglobin subunit gamma 1
  KO
K13824  hemoglobin subunit gamma
Organism
hsa  Homo sapiens (human)
Disease
H00228  Thalassemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    3047 (HBG1)
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 3047
NCBI-ProteinID: NP_000550
OMIM: 142200
HGNC: 4831
Ensembl: ENSG00000213934
Vega: OTTHUMG00000066681
Pharos: P69891(Tbio)
UniProt: P69891 D9YZU8
LinkDB
Structure
PDB: 
1I3D 1I3E

Position
11p15.4
AA seq 147 aa
MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPK
VKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFG
KEFTPEVQASWQKMVTAVASALSSRYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atgggtcatttcacagaggaggacaaggctactatcacaagcctgtggggcaaggtgaat
gtggaagatgctggaggagaaaccctgggaaggctcctggttgtctacccatggacccag
aggttctttgacagctttggcaacctgtcctctgcctctgccatcatgggcaaccccaaa
gtcaaggcacatggcaagaaggtgctgacttccttgggagatgccacaaagcacctggat
gatctcaagggcacctttgcccagctgagtgaactgcactgtgacaagctgcatgtggat
cctgagaacttcaagctcctgggaaatgtgctggtgaccgttttggcaatccatttcggc
aaagaattcacccctgaggtgcaggcttcctggcagaagatggtgactgcagtggccagt
gccctgtcctccagataccactga

DBGET integrated database retrieval system