KEGG   Homo sapiens (human): 3048
Entry
3048              CDS       T01001                                 

Gene name
HBG2, HBG-T1, TNCY
Definition
(RefSeq) hemoglobin subunit gamma 2
  KO
K13824  hemoglobin subunit gamma
Organism
hsa  Homo sapiens (human)
Disease
H00228  Thalassemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    3048 (HBG2)
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 3048
NCBI-ProteinID: NP_000175
OMIM: 142250
HGNC: 4832
Ensembl: ENSG00000196565
Vega: OTTHUMG00000066673
Pharos: P69892(Tbio)
UniProt: P69892 D9YZU9
LinkDB
Structure
PDB: 
1I3D 4MQJ 1I3E 4MQK 1FDH

Position
11p15.4
AA seq 147 aa
MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPK
VKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFG
KEFTPEVQASWQKMVTGVASALSSRYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atgggtcatttcacagaggaggacaaggctactatcacaagcctgtggggcaaggtgaat
gtggaagatgctggaggagaaaccctgggaaggctcctggttgtctacccatggacccag
aggttctttgacagctttggcaacctgtcctctgcctctgccatcatgggcaaccccaaa
gtcaaggcacatggcaagaaggtgctgacttccttgggagatgccataaagcacctggat
gatctcaagggcacctttgcccagctgagtgaactgcactgtgacaagctgcatgtggat
cctgagaacttcaagctcctgggaaatgtgctggtgaccgttttggcaatccatttcggc
aaagaattcacccctgaggtgcaggcttcctggcagaagatggtgactggagtggccagt
gccctgtcctccagataccactga

DBGET integrated database retrieval system