KEGG   Homo sapiens (human): 3060Help
Entry
3060              CDS       T01001                                 

Gene name
HCRT, NRCLP1, OX, PPOX
Definition
(RefSeq) hypocretin neuropeptide precursor
  KO
K05246  hypocretin (orexin) neuropeptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H01293  Narcolepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3060 (HCRT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Orexin
Motif
Other DBs
NCBI-GeneID: 3060
NCBI-ProteinID: NP_001515
OMIM: 602358
HGNC: 4847
Ensembl: ENSG00000161610
Vega: OTTHUMG00000180107
Pharos: O43612(Tbio)
CPD: C16105 C16106
UniProt: O43612
LinkDB All DBs
Structure
PDB: 

Position
17q21.2
AA seq 131 aa AA seqDB search
MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHA
AGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCSAPAA
ASVAPGGQSGI
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttccttccacaaaggtctcctgggccgccgtgacgctactgctgctgctgctg
ctgctgccgcccgcgctgttgtcgtccggggcggctgcacagcccctgcccgactgctgt
cgtcaaaagacttgctcttgccgcctctacgagctgctgcacggcgcgggcaatcacgcg
gccggcatcctcacgctgggcaagcggaggtccgggcccccgggcctccagggtcggctg
cagcgcctcctgcaggccagcggcaaccacgccgcgggcatcctgaccatgggccgccgc
gcaggcgcagagccagcgccgcgcccctgcctcgggcgccgctgttccgccccggccgcc
gcctccgtcgcgcccggaggacagtccgggatctga

DBGET integrated database retrieval system