KEGG   Homo sapiens (human): 3061
Entry
3061              CDS       T01001                                 

Gene name
HCRTR1, OX1R
Definition
(RefSeq) hypocretin receptor 1
  KO
K04238  hypocretin (orexin) receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Almorexant: D09964
Daridorexant (DG03119): D11886 D11887
Filorexant: D10345
Lemborexant: D11022<JP/US>
Suvorexant: D10082<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3061 (HCRTR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3061 (HCRTR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Orexin
    3061 (HCRTR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw 7tm_4 Orexin_rec2
Other DBs
NCBI-GeneID: 3061
NCBI-ProteinID: NP_001516
OMIM: 602392
HGNC: 4848
Ensembl: ENSG00000121764
Vega: OTTHUMG00000003876
Pharos: O43613(Tclin)
UniProt: O43613
LinkDB
Position
1p35.2
AA seq 425 aa
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggagccctcagccaccccaggggcccagatgggggtcccccctggcagcagagagccg
tcccctgtgcctccagactatgaagatgagtttctccgctatctgtggcgcgattatctg
tacccaaaacagtatgagtgggtcctcatcgcagcctatgtggctgtgttcgtcgtggcc
ctggtgggcaacacgctggtctgcctggccgtgtggcggaaccaccacatgaggacagtc
accaactacttcattgtcaacctgtccctggctgacgttctggtgactgctatctgcctg
ccggccagcctgctggtggacatcactgagtcctggctgttcggccatgccctctgcaag
gtcatcccctatctacaggctgtgtccgtgtcagtggcagtgctaactctcagcttcatc
gccctggaccgctggtatgccatctgccacccactattgttcaagagcacagcccggcgg
gcccgtggctccatcctgggcatctgggctgtgtcgctggccatcatggtgccccaggct
gcagtcatggaatgcagcagtgtgctgcctgagctagccaaccgcacacggctcttctca
gtctgtgatgaacgctgggcagatgacctctatcccaagatctaccacagttgcttcttt
attgtcacctacctggccccactgggcctcatggccatggcctatttccagatattccgc
aagctctggggccgccagatccccggcaccacctcagcactggtgcggaactggaagcgc
ccctcagaccagctgggggacctggagcagggcctgagtggagagccccagccccgggcc
cgcgccttcctggctgaagtgaagcagatgcgtgcacggaggaagacagccaagatgctg
atggtggtgctgctggtcttcgccctctgctacctgcccatcagcgtcctcaatgtcctt
aagagggtgttcgggatgttccgccaagccagtgaccgcgaagctgtctacgcctgcttc
accttctcccactggctggtgtacgccaacagcgctgccaaccccatcatctacaacttc
ctcagtggcaaattccgggagcagtttaaggctgccttctcctgctgcctgcctggcctg
ggtccctgcggctctctgaaggcccctagtccccgctcctctgccagccacaagtccttg
tccttgcagagccgatgctccatctccaaaatctctgagcatgtggtgctcaccagcgtc
accacagtgctgccctga

KEGG   Homo sapiens (human): 3062
Entry
3062              CDS       T01001                                 

Gene name
HCRTR2, OX2R
Definition
(RefSeq) hypocretin receptor 2
  KO
K04239  hypocretin (orexin) receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Almorexant: D09964
Daridorexant (DG03119): D11886 D11887
Filorexant: D10345
Lemborexant: D11022<JP/US>
Seltorexant: D11269
Suvorexant: D10082<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3062 (HCRTR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3062 (HCRTR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Orexin
    3062 (HCRTR2)
SSDB
Motif
Pfam: 7tm_1 Orexin_rec2 7TM_GPCR_Srsx 7tm_4 SNARE
Other DBs
NCBI-GeneID: 3062
NCBI-ProteinID: NP_001517
OMIM: 602393
HGNC: 4849
Ensembl: ENSG00000137252
Vega: OTTHUMG00000016150
Pharos: O43614(Tclin)
UniProt: O43614 S4X0W3
LinkDB
Position
6p12.1
AA seq 444 aa
MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG
YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW
FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVS
CIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMV
LAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARR
KTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAAN
PIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKL
SEQVVLTSISTLPAANGAGPLQNW
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgtccggcaccaaattggaggactcccccccttgtcgcaactggtcatctgcttcggag
ctgaatgaaactcaagagccctttttaaaccccaccgactatgacgacgaggaattcctg
cggtacctgtggagggaatacctgcacccgaaagaatatgagtgggtcctgatcgccggg
tacatcatcgtgttcgtcgtggctctcattgggaacgtcctggtttgtgtggcagtgtgg
aagaaccaccacatgaggacggtaaccaactacttcatagtcaatctttctctggctgat
gtgctcgtgaccatcacctgccttccagccacactggtcgtggatatcactgagacctgg
ttttttggacagtccctttgcaaagtgattccttatctacagaccgtgtcggtgtctgtg
tctgtcctcacactgagctgtatcgccttggatcggtggtatgcaatctgtcaccctttg
atgtttaagagcacagcaaagcgggcccgtaacagcattgtcatcatctggattgtctcc
tgcattataatgattcctcaggccatcgtcatggagtgcagcaccgtgttcccaggctta
gccaataaaaccaccctctttacggtgtgtgatgagcgctggggtggtgaaatttatccc
aagatgtaccacatctgtttctttctggtgacatacatggcaccactgtgtctcatggtg
ttggcttatctgcaaatatttcgcaaactctggtgtcgacagatccctggaacatcatct
gtagttcagagaaaatggaagcccctgcagcctgtttcacagcctcgagggccaggacag
ccaacgaagtcccggatgagcgctgtggcggctgaaataaagcagatccgagccagaagg
aaaacagcccggatgttgatgattgtgcttttggtatttgcaatttgctatctaccaatt
agcatcctcaatgtgctaaagagagtatttgggatgtttgcccatactgaagacagagag
actgtgtatgcctggtttaccttttcacactggcttgtatatgccaatagtgctgcgaat
ccaattatttataattttctcagtggaaaatttcgagaggaatttaaagctgcgttttct
tgctgttgccttggagttcaccatcgccaggaggatcggctcaccaggggacgaactagc
acagagagccggaagtccttgaccactcaaatcagcaactttgataacatatcaaaactt
tctgagcaagttgtgctcactagcataagcacactcccagcagccaatggagcaggacca
cttcaaaactggtag

DBGET integrated database retrieval system