KEGG   Homo sapiens (human): 3064
Entry
3064              CDS       T01001                                 

Gene name
HTT, HD, IT15, LOMARS
Definition
(RefSeq) huntingtin
  KO
K04533  huntingtin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06410  Calcium signaling
nt06413  Autophagy
nt06414  Apoptosis
nt06416  TNF signaling
nt06418  Oxidative phosphorylation
nt06419  Microtubule-based transport
nt06420  Ubiquitin-proteasome system
nt06440  Transcription
nt06461  Huntington disease
  Element
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N00979  Mutation-caused aberrant Htt to anterograde axonal transport
N00980  Mutation-caused aberrant Htt to REST-mediated transcriptional repression
N00981  Mutation-caused aberrant Htt to CREB-mediated transcription
N00982  Mutation-caused aberrant Htt to p53-mediated transcription
N00983  Mutation-caused aberrant Htt to extrinsic apoptotic pathway
N00985  Mutation-caused aberrant Htt to mGluR5-Ca2+ -apoptotic pathway
N00986  Mutation-caused aberrant Htt to VGCC-Ca2+ -apoptotic pathway
N00987  Mutation-caused aberrant Htt to transport of calcium
N00989  Mutation-caused aberrant Htt to electron transfer in Complex II
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N00992  Mutation-caused aberrant Htt to TNF-JNK signaling pathway
N00993  Mutation-caused aberrant Htt to autophagy-vesicle nucleation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Disease
H00059  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    3064 (HTT)
   05022 Pathways of neurodegeneration - multiple diseases
    3064 (HTT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    3064 (HTT)
   04131 Membrane trafficking [BR:hsa04131]
    3064 (HTT)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    3064 (HTT)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     3064 (HTT)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    3064 (HTT)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    3064 (HTT)
SSDB
Motif
Pfam: DUF3652 HEAT HEAT_2
Other DBs
NCBI-GeneID: 3064
NCBI-ProteinID: NP_002102
OMIM: 613004
HGNC: 4851
Ensembl: ENSG00000197386
Vega: OTTHUMG00000159916
Pharos: P42858(Tchem)
UniProt: P42858
LinkDB
Structure
PDB: 
6EZ8 6N8C

Position
4p16.3
AA seq 3144 aa
MATLEKLMKAFESLKSFQQQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQPPPQA
QPLLPQPQPPPPPPPPPPGPAVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNS
PEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNG
APRSLRAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMAS
FGNFANDNEIKVLLKAFIANLKSSSPTIRRTAAGSAVSICQHSRRTQYFYSWLLNVLLGL
LVPVEDEHSTLLILGVLLTLRYLVPLLQQQVKDTSLKGSFGVTRKEMEVSPSAEQLVQVY
ELTLHHTQHQDHNVVTGALELLQQLFRTPPPELLQTLTAVGGIGQLTAAKEESGGRSRSG
SIVELIAGGGSSCSPVLSRKQKGKVLLGEEEALEDDSESRSDVSSSALTASVKDEISGEL
AASSGVSTPGSAGHDIITEQPRSQHTLQADSVDLASCDLTSSATDGDEEDILSHSSSQVS
AVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGTDNQYLGLQIGQP
QDEDEEATGILPDEASEAFRNSSMALQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGD
QENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSC
VGAAVALHPESFFSKLYKVPLDTTEYPEEQYVSDILNYIDHGDPQVRGATAILCGTLICS
ILSRSRFHVGDWMGTIRTLTGNTFSLADCIPLLRKTLKDESSVTCKLACTAVRNCVMSLC
SSSYSELGLQLIIDVLTLRNSSYWLVRTELLETLAEIDFRLVSFLEAKAENLHRGAHHYT
GLLKLQERVLNNVVIHLLGDEDPRVRHVAAASLIRLVPKLFYKCDQGQADPVVAVARDQS
SVYLKLLMHETQPPSHFSVSTITRIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTT
RALTFGCCEALCLLSTAFPVCIWSLGWHCGVPPLSASDESRKSCTVGMATMILTLLSSAW
FPLDLSAHQDALILAGNLLAASAPKSLRSSWASEEEANPAATKQEEVWPALGDRALVPMV
EQLFSHLLKVINICAHVLDDVAPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASVPL
SPKKGSEASAASRQSDTSGPVTTSKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQN
STEKFGGFLRSALDVLSQILELATLQDIGKCVEEILGYLKSCFSREPMMATVCVQQLLKT
LFGTNLASQFDGLSSNPSKSQGRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNM
VQAEQENDTSGWFDVLQKVSTQLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTT
TTCVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIF
FFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKA
DAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIADIILPML
AKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFVTPNTMASVSTVQLWISGILA
ILRVLISQSTEDIVLSRIQELSFSPYLISCTVINRLRDGDSTSTLEEHSEGKQIKNLPEE
TFSRFLLQLVGILLEDIVTKQLKVEMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAA
ATRLFRSDGCGGSFYTLDSLNLRARSMITTHPALVLLWCQILLLVNHTDYRWWAEVQQTP
KRHSLSSTKLLSPQMSGEEEDSDLAAKLGMCNREIVRRGALILFCDYVCQNLHDSEHLTW
LIVNHIQDLISLSHEPPVQDFISAVHRNSAASGLFIQAIQSRCENLSTPTMLKKTLQCLE
GIHLSQSGAVLTLYVDRLLCTPFRVLARMVDILACRRVEMLLAANLQSSMAQLPMEELNR
IQEYLQSSGLAQRHQRLYSLLDRFRLSTMQDSLSPSPPVSSHPLDGDGHVSLETVSPDKD
WYVHLVKSQCWTRSDSALLEGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLSLGMSEISG
GQKSALFEAAREVTLARVSGTVQQLPAVHHVFQPELPAEPAAYWSKLNDLFGDAALYQSL
PTLARALAQYLVVVSKLPSHLHLPPEKEKDIVKFVVATLEALSWHLIHEQIPLSLDLQAG
LDCCCLALQLPGLWSVVSSTEFVTHACSLIYCVHFILEAVAVQPGEQLLSPERRTNTPKA
ISEEEEEVDPNTQNPKYITAACEMVAEMVESLQSVLALGHKRNSGVPAFLTPLLRNIIIS
LARLPLVNSYTRVPPLVWKLGWSPKPGGDFGTAFPEIPVEFLQEKEVFKEFIYRINTLGW
TSRTQFEETWATLLGVLVTQPLVMEQEESPPEEDTERTQINVLAVQAITSLVLSAMTVPV
AGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIVEQEIQAMVSKRENIATHHLYQAWD
PVPSLSPATTGALISHEKLLLQINPERELGSMSYKLGQVSIHSVWLGNSITPLREEEWDE
EEEEEADAPAPSSPPTSPVNSRKHRAGVDIHSCSQFLLELYSRWILPSSSARRTPAILIS
EVVRSLLVVSDLFTERNQFELMYVTLTELRRVHPSEDEILAQYLVPATCKAAAVLGMDKA
VAEPVSRLLESTLRSSHLPSRVGALHGVLYVLECDLLDDTAKQLIPVISDYLLSNLKGIA
HCVNIHSQQHVLVMCATAFYLIENYPLDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCA
LRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRT
SDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVI
GEFLSNQQPYPQFMATVVYKVFQTLHSTGQSSMVRDWVMLSLSNFTQRAPVAMATWSLSC
FFVSASTSPWVAAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEELDRRAFQSVLEV
VAAPGSPYHRLLTCLRNVHKVTTC
NT seq 9435 nt   +upstreamnt  +downstreamnt
atggcgaccctggaaaagctgatgaaggccttcgagtccctcaagtccttccagcagcag
cagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcaacag
ccgccaccgccgccgccgccgccgccgcctcctcagcttcctcagccgccgccgcaggca
cagccgctgctgcctcagccgcagccgcccccgccgccgcccccgccgccacccggcccg
gctgtggctgaggagccgctgcaccgaccaaagaaagaactttcagctaccaagaaagac
cgtgtgaatcattgtctgacaatatgtgaaaacatagtggcacagtctgtcagaaattct
ccagaatttcagaaacttctgggcatcgctatggaactttttctgctgtgcagtgatgac
gcagagtcagatgtcaggatggtggctgacgaatgcctcaacaaagttatcaaagctttg
atggattctaatcttccaaggttacagctcgagctctataaggaaattaaaaagaatggt
gcccctcggagtttgcgtgctgccctgtggaggtttgctgagctggctcacctggttcgg
cctcagaaatgcaggccttacctggtgaaccttctgccgtgcctgactcgaacaagcaag
agacccgaagaatcagtccaggagaccttggctgcagctgttcccaaaattatggcttct
tttggcaattttgcaaatgacaatgaaattaaggttttgttaaaggccttcatagcgaac
ctgaagtcaagctcccccaccattcggcggacagcggctggatcagcagtgagcatctgc
cagcactcaagaaggacacaatatttctatagttggctactaaatgtgctcttaggctta
ctcgttcctgtcgaggatgaacactccactctgctgattcttggcgtgctgctcaccctg
aggtatttggtgcccttgctgcagcagcaggtcaaggacacaagcctgaaaggcagcttc
ggagtgacaaggaaagaaatggaagtctctccttctgcagagcagcttgtccaggtttat
gaactgacgttacatcatacacagcaccaagaccacaatgttgtgaccggagccctggag
ctgttgcagcagctcttcagaacgcctccacccgagcttctgcaaaccctgaccgcagtc
gggggcattgggcagctcaccgctgctaaggaggagtctggtggccgaagccgtagtggg
agtattgtggaacttatagctggagggggttcctcatgcagccctgtcctttcaagaaaa
caaaaaggcaaagtgctcttaggagaagaagaagccttggaggatgactctgaatcgaga
tcggatgtcagcagctctgccttaacagcctcagtgaaggatgagatcagtggagagctg
gctgcttcttcaggggtttccactccagggtcagcaggtcatgacatcatcacagaacag
ccacggtcacagcacacactgcaggcggactcagtggatctggccagctgtgacttgaca
agctctgccactgatggggatgaggaggatatcttgagccacagctccagccaggtcagc
gccgtcccatctgaccctgccatggacctgaatgatgggacccaggcctcgtcgcccatc
agcgacagctcccagaccaccaccgaagggcctgattcagctgttaccccttcagacagt
tctgaaattgtgttagacggtaccgacaaccagtatttgggcctgcagattggacagccc
caggatgaagatgaggaagccacaggtattcttcctgatgaagcctcggaggccttcagg
aactcttccatggcccttcaacaggcacatttattgaaaaacatgagtcactgcaggcag
ccttctgacagcagtgttgataaatttgtgttgagagatgaagctactgaaccgggtgat
caagaaaacaagccttgccgcatcaaaggtgacattggacagtccactgatgatgactct
gcacctcttgtccattgtgtccgccttttatctgcttcgtttttgctaacagggggaaaa
aatgtgctggttccggacagggatgtgagggtcagcgtgaaggccctggccctcagctgt
gtgggagcagctgtggccctccacccggaatctttcttcagcaaactctataaagttcct
cttgacaccacggaataccctgaggaacagtatgtctcagacatcttgaactacatcgat
catggagacccacaggttcgaggagccactgccattctctgtgggaccctcatctgctcc
atcctcagcaggtcccgcttccacgtgggagattggatgggcaccattagaaccctcaca
ggaaatacattttctttggcggattgcattcctttgctgcggaaaacactgaaggatgag
tcttctgttacttgcaagttagcttgtacagctgtgaggaactgtgtcatgagtctctgc
agcagcagctacagtgagttaggactgcagctgatcatcgatgtgctgactctgaggaac
agttcctattggctggtgaggacagagcttctggaaacccttgcagagattgacttcagg
ctggtgagctttttggaggcaaaagcagaaaacttacacagaggggctcatcattataca
gggcttttaaaactgcaagaacgagtgctcaataatgttgtcatccatttgcttggagat
gaagaccccagggtgcgacatgttgccgcagcatcactaattaggcttgtcccaaagctg
ttttataaatgtgaccaaggacaagctgatccagtagtggccgtggcaagagatcaaagc
agtgtttacctgaaacttctcatgcatgagacgcagcctccatctcatttctccgtcagc
acaataaccagaatatatagaggctataacctactaccaagcataacagacgtcactatg
gaaaataacctttcaagagttattgcagcagtttctcatgaactaatcacatcaaccacc
agagcactcacatttggatgctgtgaagctttgtgtcttctttccactgccttcccagtt
tgcatttggagtttaggttggcactgtggagtgcctccactgagtgcctcagatgagtct
aggaagagctgtaccgttgggatggccacaatgattctgaccctgctctcgtcagcttgg
ttcccattggatctctcagcccatcaagatgctttgattttggccggaaacttgcttgca
gccagtgctcccaaatctctgagaagttcatgggcctctgaagaagaagccaacccagca
gccaccaagcaagaggaggtctggccagccctgggggaccgggccctggtgcccatggtg
gagcagctcttctctcacctgctgaaggtgattaacatttgtgcccacgtcctggatgac
gtggctcctggacccgcaataaaggcagccttgccttctctaacaaaccccccttctcta
agtcccatccgacgaaaggggaaggagaaagaaccaggagaacaagcatctgtaccgttg
agtcccaagaaaggcagtgaggccagtgcagcttctagacaatctgatacctcaggtcct
gttacaacaagtaaatcctcatcactggggagtttctatcatcttccttcatacctcaaa
ctgcatgatgtcctgaaagctacacacgctaactacaaggtcacgctggatcttcagaac
agcacggaaaagtttggagggtttctccgctcagccttggatgttctttctcagatacta
gagctggccacactgcaggacattgggaagtgtgttgaagagatcctaggatacctgaaa
tcctgctttagtcgagaaccaatgatggcaactgtttgtgttcaacaattgttgaagact
ctctttggcacaaacttggcctcccagtttgatggcttatcttccaaccccagcaagtca
caaggccgagcacagcgccttggctcctccagtgtgaggccaggcttgtaccactactgc
ttcatggccccgtacacccacttcacccaggccctcgctgacgccagcctgaggaacatg
gtgcaggcggagcaggagaacgacacctcgggatggtttgatgtcctccagaaagtgtct
acccagttgaagacaaacctcacgagtgtcacaaagaaccgtgcagataagaatgctatt
cataatcacattcgtttgtttgaacctcttgttataaaagctttaaaacagtacacgact
acaacatgtgtgcagttacagaagcaggttttagatttgctggcgcagctggttcagtta
cgggttaattactgtcttctggattcagatcaggtgtttattggctttgtattgaaacag
tttgaatacattgaagtgggccagttcagggaatcagaggcaatcattccaaacatcttt
ttcttcttggtattactatcttatgaacgctatcattcaaaacagatcattggaattcct
aaaatcattcagctctgtgatggcatcatggccagtggaaggaaggctgtgacacatgcc
ataccggctctgcagcccatagtccacgacctctttgtattaagaggaacaaataaagct
gatgcaggaaaagagcttgaaacccaaaaagaggtggtggtgtcaatgttactgagactc
atccagtaccatcaggtgttggagatgttcattcttgtcctgcagcagtgccacaaggag
aatgaagacaagtggaagcgactgtctcgacagatagctgacatcatcctcccaatgtta
gccaaacagcagatgcacattgactctcatgaagcccttggagtgttaaatacattattt
gagattttggccccttcctccctccgtccggtagacatgcttttacggagtatgttcgtc
actccaaacacaatggcgtccgtgagcactgttcaactgtggatatcgggaattctggcc
attttgagggttctgatttcccagtcaactgaagatattgttctttctcgtattcaggag
ctctccttctctccgtatttaatctcctgtacagtaattaataggttaagagatggggac
agtacttcaacgctagaagaacacagtgaagggaaacaaataaagaatttgccagaagaa
acattttcaaggtttctattacaactggttggtattcttttagaagacattgttacaaaa
cagctgaaggtggaaatgagtgagcagcaacatactttctattgccaggaactaggcaca
ctgctaatgtgtctgatccacatcttcaagtctggaatgttccggagaatcacagcagct
gccactaggctgttccgcagtgatggctgtggcggcagtttctacaccctggacagcttg
aacttgcgggctcgttccatgatcaccacccacccggccctggtgctgctctggtgtcag
atactgctgcttgtcaaccacaccgactaccgctggtgggcagaagtgcagcagaccccg
aaaagacacagtctgtccagcacaaagttacttagtccccagatgtctggagaagaggag
gattctgacttggcagccaaacttggaatgtgcaatagagaaatagtacgaagaggggct
ctcattctcttctgtgattatgtctgtcagaacctccatgactccgagcacttaacgtgg
ctcattgtaaatcacattcaagatctgatcagcctttcccacgagcctccagtacaggac
ttcatcagtgccgttcatcggaactctgctgccagcggcctgttcatccaggcaattcag
tctcgttgtgaaaacctttcaactccaaccatgctgaagaaaactcttcagtgcttggag
gggatccatctcagccagtcgggagctgtgctcacgctgtatgtggacaggcttctgtgc
acccctttccgtgtgctggctcgcatggtcgacatccttgcttgtcgccgggtagaaatg
cttctggctgcaaatttacagagcagcatggcccagttgccaatggaagaactcaacaga
atccaggaataccttcagagcagcgggctcgctcagagacaccaaaggctctattccctg
ctggacaggtttcgtctctccaccatgcaagactcacttagtccctctcctccagtctct
tcccacccgctggacggggatgggcacgtgtcactggaaacagtgagtccggacaaagac
tggtacgttcatcttgtcaaatcccagtgttggaccaggtcagattctgcactgctggaa
ggtgcagagctggtgaatcggattcctgctgaagatatgaatgccttcatgatgaactcg
gagttcaacctaagcctgctagctccatgcttaagcctagggatgagtgaaatttctggt
ggccagaagagtgccctttttgaagcagcccgtgaggtgactctggcccgtgtgagcggc
accgtgcagcagctccctgctgtccatcatgtcttccagcccgagctgcctgcagagccg
gcggcctactggagcaagttgaatgatctgtttggggatgctgcactgtatcagtccctg
cccactctggcccgggccctggcacagtacctggtggtggtctccaaactgcccagtcat
ttgcaccttcctcctgagaaagagaaggacattgtgaaattcgtggtggcaacccttgag
gccctgtcctggcatttgatccatgagcagatcccgctgagtctggatctccaggcaggg
ctggactgctgctgcctggccctgcagctgcctggcctctggagcgtggtctcctccaca
gagtttgtgacccacgcctgctccctcatctactgtgtgcacttcatcctggaggccgtt
gcagtgcagcctggagagcagcttcttagtccagaaagaaggacaaataccccaaaagcc
atcagcgaggaggaggaggaagtagatccaaacacacagaatcctaagtatatcactgca
gcctgtgagatggtggcagaaatggtggagtctctgcagtcggtgttggccttgggtcat
aaaaggaatagcggcgtgccggcgtttctcacgccattgctaaggaacatcatcatcagc
ctggcccgcctgccccttgtcaacagctacacacgtgtgcccccactggtgtggaagctt
ggatggtcacccaaaccgggaggggattttggcacagcattccctgagatccccgtggag
ttcctccaggaaaaggaagtctttaaggagttcatctaccgcatcaacacactaggctgg
accagtcgtactcagtttgaagaaacttgggccaccctccttggtgtcctggtgacgcag
cccctcgtgatggagcaggaggagagcccaccagaagaagacacagagaggacccagatc
aacgtcctggccgtgcaggccatcacctcactggtgctcagtgcaatgactgtgcctgtg
gccggcaacccagctgtaagctgcttggagcagcagccccggaacaagcctctgaaagct
ctcgacaccaggtttgggaggaagctgagcattatcagagggattgtggagcaagagatt
caagcaatggtttcaaagagagagaatattgccacccatcatttatatcaggcatgggat
cctgtcccttctctgtctccggctactacaggtgccctcatcagccacgagaagctgctg
ctacagatcaaccccgagcgggagctggggagcatgagctacaaactcggccaggtgtcc
atacactccgtgtggctggggaacagcatcacacccctgagggaggaggaatgggacgag
gaagaggaggaggaggccgacgcccctgcaccttcgtcaccacccacgtctccagtcaac
tccaggaaacaccgggctggagttgacatccactcctgttcgcagtttttgcttgagttg
tacagccgctggatcctgccgtccagctcagccaggaggaccccggccatcctgatcagt
gaggtggtcagatcccttctagtggtctcagacttgttcaccgagcgcaaccagtttgag
ctgatgtatgtgacgctgacagaactgcgaagggtgcacccttcagaagacgagatcctc
gctcagtacctggtgcctgccacctgcaaggcagctgccgtccttgggatggacaaggcc
gtggcggagcctgtcagccgcctgctggagagcacgctcaggagcagccacctgcccagc
agggttggagccctgcacggcgtcctctatgtgctggagtgcgacctgctggacgacact
gccaagcagctcatcccggtcatcagcgactatctcctctccaacctgaaagggatcgcc
cactgcgtgaacattcacagccagcagcacgtactggtcatgtgtgccactgcgttttac
ctcattgagaactatcctctggacgtagggccggaattttcagcatcaataatacagatg
tgtggggtgatgctgtctggaagtgaggagtccaccccctccatcatttaccactgtgcc
ctcagaggcctggagcgcctcctgctctctgagcagctctcccgcctggatgcagaatcg
ctggtcaagctgagtgtggacagagtgaacgtgcacagcccgcaccgggccatggcggct
ctgggcctgatgctcacctgcatgtacacaggaaaggagaaagtcagtccgggtagaact
tcagaccctaatcctgcagcccccgacagcgagtcagtgattgttgctatggagcgggta
tctgttctttttgataggatcaggaaaggctttccttgtgaagccagagtggtggccagg
atcctgccccagtttctagacgacttcttcccaccccaggacatcatgaacaaagtcatc
ggagagtttctgtccaaccagcagccatacccccagttcatggccaccgtggtgtataag
gtgtttcagactctgcacagcaccgggcagtcgtccatggtccgggactgggtcatgctg
tccctctccaacttcacgcagagggccccggtcgccatggccacgtggagcctctcctgc
ttctttgtcagcgcgtccaccagcccgtgggtcgcggcgatcctcccacatgtcatcagc
aggatgggcaagctggagcaggtggacgtgaaccttttctgcctggtcgccacagacttc
tacagacaccagatagaggaggagctcgaccgcagggccttccagtctgtgcttgaggtg
gttgcagccccaggaagcccatatcaccggctgctgacttgtttacgaaatgtccacaag
gtcaccacctgctga

DBGET integrated database retrieval system