KEGG   Homo sapiens (human): 3065Help
Entry
3065              CDS       T01001                                 

Gene name
HDAC1, GON-10, HD1, RPD3, RPD3L1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04213  Longevity regulating pathway - multiple species
hsa04330  Notch signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05016  Huntington disease
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05220  Chronic myeloid leukemia
Network
N00118  TEL-AML1 fusion to transcriptional repression
N00375  HPV E7 to TNF-IRF1 signaling pathway
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Mocetinostat (DG01404): D09357 D09641
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tucidinostat: D10993
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    3065 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    3065 (HDAC1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    3065 (HDAC1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    3065 (HDAC1)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    3065 (HDAC1)
   05202 Transcriptional misregulation in cancers
    3065 (HDAC1)
   05206 MicroRNAs in cancer
    3065 (HDAC1)
   05203 Viral carcinogenesis
    3065 (HDAC1)
   05220 Chronic myeloid leukemia
    3065 (HDAC1)
  09163 Neurodegenerative diseases
   05016 Huntington disease
    3065 (HDAC1)
  09164 Substance dependence
   05031 Amphetamine addiction
    3065 (HDAC1)
   05034 Alcoholism
    3065 (HDAC1)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    3065 (HDAC1)
   05165 Human papillomavirus infection
    3065 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3065 (HDAC1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     3065 (HDAC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     3065 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     3065 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    3065 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    3065 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 3065
NCBI-ProteinID: NP_004955
OMIM: 601241
HGNC: 4852
Ensembl: ENSG00000116478
Vega: OTTHUMG00000007529
Pharos: Q13547(Tclin)
UniProt: Q13547 Q6IT96
LinkDB All DBs
Structure
PDB: 

Position
1p35.2-p35.1
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagacgcagggcacccggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagcgatgactacattaaattcttgcgctccatccgt
ccagataacatgtcggagtacagcaagcagatgcagagattcaacgttggtgaggactgt
ccagtattcgatggcctgtttgagttctgtcagttgtctactggtggttctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtacattgacattgatattcaccatggt
gacggcgtggaagaggccttctacaccacggaccgggtcatgactgtgtcctttcataag
tatggagagtacttcccaggaactggggacctacgggatatcggggctggcaaaggcaag
tattatgctgttaactacccgctccgagacgggattgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccagcctagtgcggtggtcttacag
tgtggctcagactccctatctggggatcggttaggttgcttcaatctaactatcaaagga
cacgccaagtgtgtggaatttgtcaagagctttaacctgcctatgctgatgctgggaggc
ggtggttacaccattcgtaacgttgcccggtgctggacatatgagacagctgtggccctg
gatacggagatccctaatgagcttccatacaatgactactttgaatactttggaccagat
ttcaagctccacatcagtccttccaatatgactaaccagaacacgaatgagtacctggag
aagatcaaacagcgactgtttgagaaccttagaatgctgccgcacgcacctggggtccaa
atgcaggcgattcctgaggacgccatccctgaggagagtggcgatgaggacgaagacgac
cctgacaagcgcatctcgatctgctcctctgacaaacgaattgcctgtgaggaagagttc
tccgattctgaagaggagggagaggggggccgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaggatgaaaaagagaaagacccagaggagaagaaagaagtcacc
gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaggaggaggtcaag
ttggcctga

DBGET integrated database retrieval system