KEGG   Homo sapiens (human): 3065Help
Entry
3065              CDS       T01001                                 

Gene name
HDAC1, GON-10, HD1, KDAC1, RPD3, RPD3L1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04213  Longevity regulating pathway - multiple species
hsa04330  Notch signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05016  Huntington disease
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05220  Chronic myeloid leukemia
Network
nt06123  TNF signaling (virus)
nt06166  Human papillomavirus (HPV)
nt06240  Transcription
  Element
N00118  TEL-AML1 fusion to transcriptional repression
N00375  HPV E7 to TNF-IRF1 signaling pathway
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Fimepinostat: D11319
Mocetinostat (DG01404): D09357 D09641
Nanatinostat: D11442
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tacedinaline: D05988
Tinostamustine: D11182
Tucidinostat: D10993
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    3065 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    3065 (HDAC1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    3065 (HDAC1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    3065 (HDAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3065 (HDAC1)
   05202 Transcriptional misregulation in cancer
    3065 (HDAC1)
   05206 MicroRNAs in cancer
    3065 (HDAC1)
   05203 Viral carcinogenesis
    3065 (HDAC1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    3065 (HDAC1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    3065 (HDAC1)
  09165 Substance dependence
   05031 Amphetamine addiction
    3065 (HDAC1)
   05034 Alcoholism
    3065 (HDAC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    3065 (HDAC1)
   05165 Human papillomavirus infection
    3065 (HDAC1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     3065 (HDAC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     3065 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     3065 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    3065 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    3065 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 3065
NCBI-ProteinID: NP_004955
OMIM: 601241
HGNC: 4852
Ensembl: ENSG00000116478
Vega: OTTHUMG00000007529
Pharos: Q13547(Tclin)
UniProt: Q13547 Q6IT96
LinkDB All DBs
Structure
PDB: 

Position
1p35.2-p35.1
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagacgcagggcacccggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagcgatgactacattaaattcttgcgctccatccgt
ccagataacatgtcggagtacagcaagcagatgcagagattcaacgttggtgaggactgt
ccagtattcgatggcctgtttgagttctgtcagttgtctactggtggttctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtacattgacattgatattcaccatggt
gacggcgtggaagaggccttctacaccacggaccgggtcatgactgtgtcctttcataag
tatggagagtacttcccaggaactggggacctacgggatatcggggctggcaaaggcaag
tattatgctgttaactacccgctccgagacgggattgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccagcctagtgcggtggtcttacag
tgtggctcagactccctatctggggatcggttaggttgcttcaatctaactatcaaagga
cacgccaagtgtgtggaatttgtcaagagctttaacctgcctatgctgatgctgggaggc
ggtggttacaccattcgtaacgttgcccggtgctggacatatgagacagctgtggccctg
gatacggagatccctaatgagcttccatacaatgactactttgaatactttggaccagat
ttcaagctccacatcagtccttccaatatgactaaccagaacacgaatgagtacctggag
aagatcaaacagcgactgtttgagaaccttagaatgctgccgcacgcacctggggtccaa
atgcaggcgattcctgaggacgccatccctgaggagagtggcgatgaggacgaagacgac
cctgacaagcgcatctcgatctgctcctctgacaaacgaattgcctgtgaggaagagttc
tccgattctgaagaggagggagaggggggccgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaggatgaaaaagagaaagacccagaggagaagaaagaagtcacc
gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaggaggaggtcaag
ttggcctga

KEGG   Homo sapiens (human): 3066Help
Entry
3066              CDS       T01001                                 

Gene name
HDAC2, HD2, KDAC2, RPD3, YAF1
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04213  Longevity regulating pathway - multiple species
hsa04330  Notch signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05016  Huntington disease
hsa05034  Alcoholism
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05220  Chronic myeloid leukemia
Network
nt06123  TNF signaling (virus)
nt06166  Human papillomavirus (HPV)
nt06240  Transcription
  Element
N00118  TEL-AML1 fusion to transcriptional repression
N00375  HPV E7 to TNF-IRF1 signaling pathway
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Fimepinostat: D11319
Mocetinostat (DG01404): D09357 D09641
Nanatinostat: D11442
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tinostamustine: D11182
Tucidinostat: D10993
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    3066 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    3066 (HDAC2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    3066 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    3066 (HDAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3066 (HDAC2)
   05202 Transcriptional misregulation in cancer
    3066 (HDAC2)
   05206 MicroRNAs in cancer
    3066 (HDAC2)
   05203 Viral carcinogenesis
    3066 (HDAC2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    3066 (HDAC2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    3066 (HDAC2)
  09165 Substance dependence
   05034 Alcoholism
    3066 (HDAC2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    3066 (HDAC2)
   05165 Human papillomavirus infection
    3066 (HDAC2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     3066 (HDAC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     3066 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     3066 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    3066 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    3066 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 3066
NCBI-ProteinID: NP_001518
OMIM: 605164
HGNC: 4853
Ensembl: ENSG00000196591
Vega: OTTHUMG00000015411
Pharos: Q92769(Tclin)
UniProt: Q92769
LinkDB All DBs
Structure
PDB: 

Position
6q21
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaaaaaaaaagtctgctactactacgacggtgatatt
ggaaattattattatggacagggtcatcccatgaagcctcatagaatccgcatgacccat
aacttgctgttaaattatggcttatacagaaaaatggaaatatataggccccataaagcc
actgccgaagaaatgacaaaatatcacagtgatgagtatatcaaatttctacggtcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgttggagaagat
tgtccagtgtttgatggactctttgagttttgtcagctctcaactggcggttcagttgct
ggagctgtgaagttaaaccgacaacagactgatatggctgttaattgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttacgttaatgatattgtgcttgcc
atccttgaattactaaagtatcatcagagagtcttatatattgatatagatattcatcat
ggtgatggtgttgaagaagctttttatacaacagatcgtgtaatgacggtatcattccat
aaatatggggaatactttcctggcacaggagacttgagggatattggtgctggaaaaggc
aaatactatgctgtcaattttccaatgagagatggtatagatgatgagtcatatgggcag
atatttaagcctattatctcaaaggtgatggagatgtatcaacctagtgctgtggtatta
cagtgtggtgcagactcattatctggtgatagactgggttgtttcaatctaacagtcaaa
ggtcatgctaaatgtgtagaagttgtaaaaacttttaacttaccattactgatgcttgga
ggaggtggctacacaatccgtaatgttgctcgatgttggacatatgagactgcagttgcc
cttgattgtgagattcccaatgagttgccatataatgattactttgagtattttggacca
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttgtttgaaaatttgcgcatgttacctcatgcacctggtgtc
cagatgcaagctattccagaagatgctgttcatgaagacagtggagatgaagatggagaa
gatccagacaagagaatttctattcgagcatcagacaagcggatagcttgtgatgaagaa
ttctcagattctgaggatgaaggagaaggaggtcgaagaaatgtggctgatcataagaaa
ggagcaaagaaagctagaattgaagaagataagaaagaaacagaggacaaaaaaacagac
gttaaggaagaagataaatccaaggacaacagtggtgaaaaaacagataccaaaggaacc
aaatcagaacagctcagcaacccctga

KEGG   Homo sapiens (human): 25942Help
Entry
25942             CDS       T01001                                 

Gene name
SIN3A, WITKOS
Definition
(RefSeq) SIN3 transcription regulator family member A
  KO
K11644  paired amphipathic helix protein Sin3a
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
hsa05016  Huntington disease
hsa05169  Epstein-Barr virus infection
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00118  TEL-AML1 fusion to transcriptional repression
Disease
H01861  Chromosome 15q24 microdeletion syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    25942 (SIN3A)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    25942 (SIN3A)
  09164 Neurodegenerative disease
   05016 Huntington disease
    25942 (SIN3A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    25942 (SIN3A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     25942 (SIN3A)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    25942 (SIN3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sin3a_C PAH Sin3_corepress
Motif
Other DBs
NCBI-GeneID: 25942
NCBI-ProteinID: NP_001138829
OMIM: 607776
HGNC: 19353
Ensembl: ENSG00000169375
Vega: OTTHUMG00000142834
Pharos: Q96ST3(Tbio)
UniProt: Q96ST3
LinkDB All DBs
Position
15q24.2
AA seq 1273 aa AA seqDB search
MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTP
SYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQR
LKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIM
GFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQ
PAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQ
PVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYA
QVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRP
SQNGCQIRRHPTGTTPPVKKKPKLLNLKDSSMADASKHGGGTESLFFDKVRKALRSAEAY
ENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLETYPKERATE
GIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSS
KKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGT
SEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQ
NEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLA
YEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEE
EMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQ
ILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYP
AFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQV
TDLYLAENNNGATGGQLNTQNSRSLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTIE
LLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGR
EQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHE
RVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSIN
KYRVKYGTVFKAP
NT seq 3822 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcgtttggatgaccaggagtcaccggtgtatgcagcccagcagcgtcggatc
cctggcagcacagaggcttttcctcaccagcaccgggtgcttgcccctgcccctcctgtg
tatgaagcagtgtctgagaccatgcagtcagctacgggaattcagtactctgtaacaccc
agctaccaggtttcagccatgccacagagctccggcagtcatgggcccgctatagcagca
gttcatagcagccatcatcacccaacagcggtgcagccccacggaggccaggtggtccag
agtcatgctcatccagccccaccagttgcaccagtgcagggacagcagcaatttcagagg
ctgaaggtggaggatgcgctatcttatcttgaccaggtgaagctgcagtttggtagtcag
cctcaggtctacaatgatttccttgacatcatgaaggaatttaaatctcagagcatcgac
accccaggagtgattagtcgtgtgtcccagctattcaaaggccaccccgatctgataatg
ggattcaacaccttcttgccccctggctacaaaattgaggtgcaaaccaatgacatggtg
aatgtgacaactcctggccaggttcatcagattcccacccatggcatccagccacagcct
caaccaccaccccaacatccttcccagccttcagcccagtcagccccagctcctgcccag
ccagctcctcagcccccacctgccaaagtcagcaagccctcccaactgcaagcacatact
ccggccagtcagcagactcccccacttccaccgtatgcatccccacgttctccgccggtc
cagcctcacacaccagtgacaatctcgttgggaacggccccatccttgcagaacaatcaa
cctgtggagtttaatcatgccatcaactatgttaataagatcaagaacagatttcagggc
caaccagacatctacaaagcattcctggagattttgcacacatatcagaaagagcagaga
aatgccaaggaagctggaggaaactacactccagcattgacagagcaggaggtgtatgcc
caggttgctcgtctctttaaaaaccaggaagatttgttgtcagagtttggacaattccta
ccagatgccaacagctccgtgcttttaagcaaaacaactgctgagaaggttgattctgtg
agaaatgatcatggaggcactgtcaagaagccccaactgaacaacaagccgcagaggccc
agccagaatggctgccagatccgcagacatcctacaggaaccacccctccagttaagaag
aaacccaaactgctcaatctgaaggattcttctatggcagatgccagcaaacatggtggt
ggaacagaatcgttattttttgataaggtccgaaaggctcttcggagtgcagaagcctac
gaaaatttcctacgctgtcttgttatttttaaccaggaggtgatctctcgtgctgagctt
gtgcaactagtctctcctttcctggggaaattccctgagttgtttaattggtttaaaaac
tttctgggctataaggagtctgtacatctggaaacttatccaaaggagcgagccacagag
ggcattgctatggagatagattatgcttcttgtaaacgattgggctccagctatcgagcc
ttaccaaagagttaccagcagcccaagtgtacaggacggactcctctctgtaaagaggtt
ttaaatgatacctgggtttccttcccttcgtggtctgaggactctacctttgtgagttcc
aagaagactcaatatgaagaacatatttatcgttgtgaagatgaacgctttgagcttgat
gtagttttagagaccaatctggcaacaatccgggttctggaagcaatacagaagaagctt
tcccgcttgtctgctgaagaacaagccaaatttcgcttggacaacacccttgggggcaca
tcagaagtcatccatagaaaagcactccagaggatatatgctgataaagcagctgacatc
attgatggtctgagaaagaatccctccattgctgttccaattgtccttaaaaggttgaag
atgaaagaggaagaatggcgagaagctcagagaggctttaacaaagtatggcgagaacaa
aatgagaaatactacttgaagtctctggaccaccaggggatcaactttaaacagaatgac
accaaggtcctgaggtctaagagcttactcaatgagattgagagtatctatgatgagagg
caagagcaggctacggaggagaatgctggtgtacctgttggcccacacctctcacttgcg
tatgaagacaaacaaatactggaagatgctgctgctctgattatccaccatgtgaagagg
cagacaggcattcagaaggaggacaaatataagataaaacaaatcatgcatcattttatt
ccagatttgctctttgcccaaagaggtgatctctcagatgtggaggaagaggaagaagaa
gagatggatgtagatgaagccacaggggcagttaagaagcacaatggtgttgggggcagt
ccccctaagtccaagttactgtttagtaacacagcagctcaaaaattaagaggaatggat
gaagtatacaacctcttctatgtcaacaacaactggtatatttttatgcgactgcaccag
attctctgcctgaggctgctacggatttgttcccaagccgaacggcaaattgaagaagaa
aaccgagagagagaatgggaacgggaagtgctgggcataaagcgagacaagagtgacagc
cctgccattcagctacgtctcaaagaacctatggatgttgatgtagaagattattaccca
gctttcctggacatggtgcggagcctgctggatggcaacatagactcatcacagtatgaa
gattcactgagagagatgttcaccattcatgcctacattgcctttaccatggacaaactg
atccagagcattgtcagacagctgcagcatatcgtgagtgatgagatctgtgtgcaggtg
actgacctttacctggcagaaaataataatggggccaccggaggccagctgaacacacag
aactcaaggagcctcctggagtcaacgtatcagcggaaagctgagcagctaatgtcagat
gagaattgctttaagcttatgtttattcagagccaaggccaggtccagctgactattgag
cttctggacacagaagaggagaattcggatgaccctgtggaagcagagcgctggtcagac
tacgtggagcgatacatgaattcagatactacctcgcctgagcttcgtgaacatctagca
cagaaaccagtatttctccccaggaatctacggcggatccggaagtgtcaacgtggtcga
gagcagcaggaaaaggaagggaaggaaggaaacagcaagaagaccatggagaatgtggat
agtctggataagctggagtgtagattcaagctgaattcctacaagatggtgtatgtgatc
aaatcagaggactatatgtatcggaggaccgccctgctccgggctcatcagtcccatgag
cgtgtaagcaagcgtctacatcagagattccaggcctgggtagataaatggaccaaggag
catgtgccccgtgaaatggcagcagagaccagcaagtggctcatgggtgaggggctggag
ggcctggtgccctgtaccaccacctgtgatacagagaccctgcattttgtgagcattaac
aagtatcgtgtcaaatacggcacagtattcaaagccccttaa

KEGG   Homo sapiens (human): 9611Help
Entry
9611              CDS       T01001                                 

Gene name
NCOR1, N-CoR, N-CoR1, PPP1R109, TRAC1, hN-CoR
Definition
(RefSeq) nuclear receptor corepressor 1
  KO
K04650  nuclear receptor co-repressor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04919  Thyroid hormone signaling pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00118  TEL-AML1 fusion to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    9611 (NCOR1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    9611 (NCOR1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    9611 (NCOR1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     9611 (NCOR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GPS2_interact Myb_DNA-binding Myb_DNA-bind_6
Motif
Other DBs
NCBI-GeneID: 9611
NCBI-ProteinID: NP_006302
OMIM: 600849
HGNC: 7672
Ensembl: ENSG00000141027
Vega: OTTHUMG00000059309
Pharos: O75376(Tchem)
UniProt: O75376 A0A024RD47
LinkDB All DBs
Structure
PDB: 

Position
17p12-p11.2
AA seq 2440 aa AA seqDB search
MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQ
QQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQ
RVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEE
LIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIY
DENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHAR
KQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQ
RVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINM
NGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYL
TKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDE
KEDSKENTKEKDKIDGTAEETEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAA
AAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEA
QCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEE
ENPEDSEVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVPSTKPAEDESV
ETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDN
TKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFP
MDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALY
QRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPNREWEVLQPAPHQVITNLPE
GVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLTSHNQASYTQETPK
PSVGSISLGLPRQQESAKSATLPYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAIQ
EGSITRGTPTSKISVESIPSLRGSITQGTPALPQTGIPTEALVKGSISRMPIEDSSPEKG
REEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGNIKQGMSM
RESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKR
ESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEG
SISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKA
GETVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDTSARRTPVSYQNTMSRGSPMMN
RTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRGSTAGEVY
RSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITS
QQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITY
IPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRP
GSEQPGRPGSHGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPA
GGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAV
SEQQQLEQKTLEVEKRSVQCLYTSSAFPSGKPQPHSSVVYSEAGKDKGPPPKSRYEEELR
TRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETPSDAIEVISPAS
SPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQLPPSSQAEGMG
QVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNR
YSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHE
KQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSG
GGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVE
DHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIP
GQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTP
IACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD
NT seq 7323 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagttcaggttatcctcccaaccaaggagcattcagcacagaacaaagtcgttat
cctcctcactctgtccagtatacatttcccaacacccgccaccagcaggagttcgcagtc
cctgattatcgttcctctcatcttgaagtgagtcaggcatcacagcttttgcagcaacag
cagcagcaacagcttcgaaggcgaccttccttgctttcagaatttcacccaggttctgac
aggcctcaagaaaggagaactagttatgaaccgtttcatccaggcccatccccagtggat
catgattcactggaatcgaagcgaccacgtctggaacaggtttctgattctcattttcag
cgtgtcagtgctgcggttttgcctttagtgcacccgctgccagaagggctgagggcttct
gcagatgctaagaaggatccagcattcggaggcaaacatgaagctccatcctctccaatt
tcggggcaaccatgtggagatgatcaaaatgcttcaccttcaaaactctcaaaggaagag
ttaatacagagtatggatcgtgtagatcgagaaattgcaaaagtagaacagcagatcctt
aaactgaaaaagaaacaacaacagcttgaagaagaggcagctaaacctcctgagcctgag
aagcccgtgtcccctcctcctgtggagcagaaacaccgcagtattgtccaaattatttat
gatgagaatcggaaaaaagcagaagaagctcataaaatttttgaaggtcttggcccaaaa
gttgaactgccactgtataaccagccatcagataccaaggtgtaccatgagaacatcaag
acaaaccaggtgatgaggaaaaaactcattttattttttaaaagaagaaatcatgcaaga
aaacaaagggaacaaaaaatctgccagcgttatgatcagctcatggaggcatgggagaaa
aaagtggacagaatagaaaataatcctcggaggaaagctaaagaaagcaaaacaagggaa
tactatgaaaagcagtttccagaaattcgaaaacaaagagaacagcaagaaagatttcag
cgagttgggcagaggggagctggtctttcagccaccattgctaggagtgagcatgagatt
tctgaaattattgatgggctctctgagcaggagaataatgagaaacaaatgcggcagctc
tctgtgattccacctatgatgtttgatgcagaacaaagacgagtcaagttcattaacatg
aatgggcttatggaggaccctatgaaagtgtataaagataggcagtttatgaatgtttgg
actgaccatgaaaaggagatctttaaggacaagtttatccagcatccaaaaaactttgga
ctaattgcatcatacttggagaggaagagtgttcctgattgtgttttgtattactattta
accaagaaaaatgagaattataaagccctcgtcagaaggaattatgggaaacgcagaggc
agaaaccagcaaattgctcgaccctcgcaagaagaaaaagtagaagaaaaagaagaggat
aaagcagaaaaaacagaaaaaaaagaagaagaaaagaaagatgaagaggaaaaagatgaa
aaagaagactccaaagaaaataccaaggaaaaggacaagatagatggtacagcagaagaa
actgaggaaagagagcaagccacaccccgggggcgaaagactgccaacagtcagggccgc
cgtaagggccggatcaccaggtccatgacaaacgaagctgcagctgccagtgctgcagcc
gcagcggctactgaagagcccccaccacctctgccaccgccaccagaacccatttctaca
gagcctgtggagacctctcgatggacagaagaagaaatggaagttgctaaaaaaggtcta
gtagaacatggtcgtaactgggcagcaattgctaaaatggtgggaacgaaaagtgaagct
caatgtaaaaacttctattttaactataaaaggcgacacaatcttgacaacctcttacag
cagcataaacagaaaacttcacgaaaacctcgtgaagagcgagatgtgtctcaatgtgaa
agtgtcgcttccactgtttctgctcaggaggatgaagatattgaagcctccaatgaagaa
gaaaatccagaagacagcgaagttgaagctgtcaagcccagcgaggacagtcctgaaaat
gctacttctcgaggaaacacagaacctgcggttgagcttgagcccaccacggaaactgca
cccagtacatctccctccttagcagttccaagtacaaaaccagctgaagatgaaagtgtg
gagacccaggtgaatgacagcatcagtgctgagacagcagagcagatggatgtagatcag
caggagcacagtgctgaagagggttctgtttgtgatcccccacccgctaccaaagctgac
tctgtggacgttgaagtgagggtgccagaaaaccatgcatctaaagttgaaggtgataat
accaaagaaagagacttggatagagccagtgagaaggtggaacctagagatgaagatttg
gtggtagctcagcaaataaatgcccaaaggcccgagccccagtcagacaatgattccagt
gccacgtgcagcgctgatgaggatgtggatggagagccagagaggcagagaatgtttcct
atggactcaaagccttcactgttaaaccccactggatctatactcgtctcatctccgtta
aaaccaaatccactggatctgccacagcttcagcatcgagctgctgttatcccaccaatg
gtatcctgcaccccatgtaacataccaattggaaccccagtgagcggctatgctctctac
cagcgacacattaaagcaatgcatgagtcagcactcctggaggagcagcggcagagacaa
gaacagatagatttggaatgtagaagttctacaagtccatgtggcacatccaagagtcca
aacagagagtgggaagtccttcagcctgctccacatcaagtgataactaatctccctgaa
ggcgttcggcttccgacaactcgaccaaccaggccaccgccccctctcatcccgtcatcc
aaaaccacagtggcttcagaaaaaccatcttttataatgggaggctccatctcacaggga
acaccaggcacttatttgacttctcataatcaggcttcctacactcaagaaacacccaag
ccgtcagtgggatctatctctcttggactgccacggcaacaggaatctgccaaatcagct
actttgccctacatcaagcaggaagaattttctccccgaagccaaaactcacaacctgag
ggtctgttggtcagggcccaacatgaaggtgtagtcagaggtaccgcaggagccatacaa
gaaggaagtataactcggggaactccaaccagcaaaatttcagtggagagcattccatcc
ctacggggctctatcactcagggcaccccggctctgccccagactggcataccaacagag
gctttggtgaaggggtccatttcgagaatgcccattgaagacagcagtcctgagaaaggc
agagaggaagctgcatccaaaggccatgttatttatgaaggcaaaagtggacatatcttg
tcatatgataatattaagaatgcccgagaagggactaggagtccaagaacagctcatgaa
atcagtttaaagagaagctatgaatcagtggaaggaaatataaagcaagggatgtcaatg
agggagtctcctgtatcagcaccgttagaggggctgatatgccgagcattacccaggggg
agtcctcattctgacctcaaagaaaggactgtattgtctggctccataatgcaggggaca
ccaagagcaacaactgaaagctttgaagatggccttaaatatcccaaacaaattaaaagg
gaaagtcctcccatacgagcatttgaaggtgccattaccaaaggaaaaccatatgatggc
atcaccaccatcaaagaaatggggcgttccattcatgagattccaaggcaagatatttta
actcaggaaagtcggaaaactccagaagtggtccagagcacacggccgataattgagggt
tccatttcccagggcacaccaataaagtttgacaacaactcaggtcaatctgccatcaaa
cacaatgtcaaatccttaatcacggggcctagcaaactatcccgtggaatgcctccgctg
gaaattgtgccagagaacataaaagtggtagaacggggaaaatatgaggatgtgaaagca
ggcgagaccgtgcgttcccggcacacgtcagtggtaagctctggcccctccgttcttagg
tccacactgcatgaagctcccaaagcacaactgagccctgggatttatgatgacaccagt
gcacggaggacccctgtgagttatcaaaacaccatgtccagaggctcacccatgatgaac
agaacttctgatgttacaatttcttctaacaagtctaccaatcatgaaaggaaatcgaca
ctgacccctacccagagggaaagtatcccagcgaagtctccagtgcctggggtggaccct
gtcgtgagccacagtccgtttgatccccatcacagaggcagcactgcaggcgaggtttat
cggagccacctgcccacgcacttggatccagccatgccttttcacagggctttggatcct
gcagcggctgcttacctgtttcagagacagctttcaccaactccaggttacccaagtcag
tatcagctttacgcaatggagaacacaagacagacaatcttaaatgattacattacctca
caacagatgcaagtgaacttgcgtccagatgtggccagaggactctccccaagagagcag
ccactgggtctcccatacccagcaacgagaggaatcattgacctgaccaatatgcctcca
acaattttagtgcctcatccagggggaacaagcactcctcccatggacagaatcacttat
attcctggtacacagattactttccctcccaggccgtacaactctgcttccatgtctcca
ggacacccaacacaccttgcagctgctgcaagtgctgagagggaacgggaacgggagcgg
gagaaggagcgggagcgggaacggattgctgcagcttcctccgacctctacctgcggcca
ggctcagaacagcctggccgacctggcagtcatggatatgttcgctccccttccccttca
gtaagaactcaggagaccatgttgcaacagagacccagtgttttccaaggaaccaatgga
accagtgtaatcacacctttggatccaactgctcagctacgaatcatgccactgcctgct
gggggcccttcaataagccaaggcctgccagcctcccgttacaacactgctgcggatgcc
ctggctgctcttgtggatgctgcagcttctgcaccccagatggatgtgtccaaaacaaaa
gagagtaagcatgaagctgccaggttagaagaaaatttgagaagcaggtcagcagcagtt
agtgaacagcagcagctagagcagaaaaccctggaggtggagaagagatctgttcagtgt
ttatacacttcttcagcctttccaagtggcaagccccagcctcattcttcagtagtttat
tctgaggctgggaaagataaagggcctcctccaaaatccagatatgaggaagagctaagg
accagagggaagactaccattactgcagctaacttcatagacgtgatcatcacccggcaa
attgcctcggacaaggatgcgagggaacgtggctctcaaagttcagactcttctagtagc
ttatcttctcacaggtatgaaacacctagcgatgctattgaggtgataagtcctgccagc
tcacctgcgccaccccaggagaaactgcagacctatcagccagaggttgttaaggcaaat
caagcggaaaatgatcctaccagacaatatgaaggaccattacatcactatcgaccacag
caggaatcaccatctccccaacaacagctgcccccttcttcacaggcagagggaatgggg
caagtgcccaggacccatcggctgatcacacttgctgatcacatctgtcaaattatcaca
caagattttgctagaaatcaagtttcctcgcagactccccagcagcctcctacttctaca
ttccagaactcaccttctgctttggtatctacacctgtgaggactaaaacatcaaaccgt
tacagcccagaatcccaggctcagtctgtccatcatcaaagaccaggttcaagggtctct
ccagaaaatcttgtggacaaatccaggggaagtaggcctggaaaatccccagagaggagt
cacgtctcttcggagccctacgagcccatctccccaccccaggttccggttgtgcatgag
aaacaggacagcttgctgctcttgtctcagaggggcgcagagcctgcagagcagaggaat
gatgcccgctcaccagggagtataagctacttgccttcattcttcaccaagcttgaaaat
acatcacccatggttaaatcaaagaagcaggagatttttcgtaagttgaactcctctggt
ggaggtgactctgatatggcagctgctcagccaggaactgagatctttaatctgccagca
gttactacgtcaggctcagttagctctagaggccattcttttgctgatcctgccagtaat
cttgggctggaagacattatcaggaaggctctcatgggaagctttgatgacaaagttgag
gatcatggagttgtcatgtcccagcctatgggagtagtgcctggtactgccaacacctca
gttgtgaccagtggtgagacacgaagagaggaaggggacccatcacctcattcaggagga
gtttgcaaaccaaagctgatcagcaagtcaaacagcaggaaatctaagtctcctatacct
gggcaaggctacttaggaacggaacggccctcttcagtctcctctgtacattcagaaggg
gattaccataggcagacgccagggtgggcctgggaagacaggccctcttcaacaggctca
actcagtttccttataaccctctgactatgcggatgctcagcagtactccaccaacaccg
attgcatgtgctccctctgcggtgaaccaagcagctcctcaccaacagaacaggatctgg
gagcgagagcctgccccactgctctcagcacagtacgagaccctgtcggatagtgatgac
tga

DBGET integrated database retrieval system