KEGG   Homo sapiens (human): 3081Help
Entry
3081              CDS       T01001                                 

Gene name
HGD, AKU, HGO
Definition
(RefSeq) homogentisate 1,2-dioxygenase
  KO
K00451  homogentisate 1,2-dioxygenase [EC:1.13.11.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00350  Tyrosine metabolism
hsa01100  Metabolic pathways
Module
hsa_M00044  Tyrosine degradation, tyrosine => homogentisate
Network
nt06016  Phenylalanine and tyrosine metabolism
  Element
N00708  Tyrosine degradation
N00709  FAH deficiency in tyrosine degradation
N00712  HGD deficiency in tyrosine degradation
Disease
H00163  Alkaptonuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    3081 (HGD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.5  homogentisate 1,2-dioxygenase
     3081 (HGD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HgmA
Motif
Other DBs
NCBI-GeneID: 3081
NCBI-ProteinID: NP_000178
OMIM: 607474
HGNC: 4892
Ensembl: ENSG00000113924
Vega: OTTHUMG00000159441
Pharos: Q93099(Tbio)
UniProt: Q93099
LinkDB All DBs
Structure
PDB: 

Position
3q13.33
AA seq 445 aa AA seqDB search
MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSW
LYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLC
GAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEIC
VIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVP
GGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTV
LTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPG
GGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLD
ENYHKCWEPLKSHFTPNSRNPAEPN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctgagttaaagtacatttctggatttgggaatgagtgttcttcagaggatcctcgc
tgcccaggttccctgccagaaggacagaataatcctcaggtctgcccctacaatctctat
gctgagcagctctcaggatcggctttcacttgtccacggagcaccaataagagaagctgg
ctgtataggattctaccttcagtttctcacaagccctttgaatccattgacgaaggccaa
gtcactcacaactgggatgaagttgatcctgatcctaaccagcttagatggaaaccattt
gagattccaaaagcatctcagaagaaagtagactttgtgagtggcctgcataccttgtgt
ggagctggagacataaagtctaacaatgggcttgctatccacattttcctctgcaatacc
tccatggagaacagatgcttttacaattcagatggggacttcttgattgttccgcagaaa
gggaaccttctcatttacaccgagtttggcaagatgcttgtacagcccaatgagatctgc
gtcattcagagaggaatgcggttcagcatagatgtctttgaggagaccaggggctacatc
ttggaggtctatggtgtccactttgagttacctgaccttggaccaattggggccaatggc
ttggccaatcctcgtgatttcttgatacccattgcctggtatgaggatcgccaagtacca
ggtggttacacggtcattaataaataccagggcaagctgtttgctgccaaacaggatgtc
tccccgttcaatgttgtggcctggcacgggaattatacaccctacaagtacaacctgaag
aatttcatggttatcaactcagtggcctttgaccatgcagacccatccattttcacagta
ttgactgctaagtctgtccgccctggagtggccattgctgattttgtcatcttcccacct
cgatggggggttgctgataagaccttcaggcctccttattaccataggaactgcatgagt
gagttcatgggactcatccgaggtcactatgaggcaaagcaaggtgggttcctgccaggg
ggagggagtctacacagcacaatgaccccccatggacctgatgctgactgctttgagaag
gccagcaaggtcaagctggcacctgagaggattgccgatggcaccatggcatttatgttt
gaatcatctttaagtctggcggtcacaaagtggggactcaaggcctccaggtgtttggat
gagaactaccacaagtgctgggagccactcaagagccacttcactcccaactccaggaac
ccagcagaacctaattga

DBGET integrated database retrieval system