KEGG   Homo sapiens (human): 3084
Entry
3084              CDS       T01001                                 

Gene name
NRG1, ARIA, GGF, GGF2, HGL, HRG, HRG1, HRGA, MST131, MSTP131, NDF, NRG1-IT2, SMDF
Definition
(RefSeq) neuregulin 1
  KO
K05455  neuregulin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04012  ErbB signaling pathway
hsa05014  Amyotrophic lateral sclerosis
Network
nt06415  PI3K signaling
nt06464  Amyotrophic lateral sclerosis
  Element
N01163  NRG-ERBB4-PI3K signaling pathway
N01164  Mutation-inactivated ERBB4 to NRG-ERBB4-PI3K signaling pathway
Disease
H01649  Schizophrenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    3084 (NRG1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    3084 (NRG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    3084 (NRG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3084 (NRG1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3084 (NRG1)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   3084 (NRG1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   3084 (NRG1)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 V-set EGF EGF_2 hEGF Ig_6 Ig_4 BiPBP_C Cyt_b-c1_8 Laminin_EGF
Other DBs
NCBI-GeneID: 3084
NCBI-ProteinID: NP_039258
OMIM: 142445
HGNC: 7997
Ensembl: ENSG00000157168
Vega: OTTHUMG00000163918
Pharos: Q02297(Tbio)
UniProt: Q02297 Q6PK61
LinkDB
Structure
PDB: 
1HAE 1HAF 1HRE 1HRF

Position
8p12
AA seq 640 aa
MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETS
SEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGN
DSASANITIVESNEIITGMPASTEGAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLV
KCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQ
KRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMMNIANGPHHPN
PPPENVQLVNQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPSHSWSNGHT
ESILSESHSVIVMSSVENSRHSSPTGGPRGRLNGTGGPRECNSFLRHARETPDSYRDSPH
SERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSMAVSPFMEEERPLLL
VTPPRLREKKFDHHPQQFSSFHHNPAHDSNSLPASPLRIVEDEEYETTQEYEPAQEPVKK
LANSRRAKRTKPNGHIANRLEVDSNTSSQSSNSESETEDERVGEDTPFLGIQNPLAASLE
ATPAFRLADSRTNPAGRFSTQEEIQARLSSVIANQDPIAV
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgtccgagcgcaaagaaggcagaggcaaagggaagggcaagaagaaggagcgaggctcc
ggcaagaagccggagtccgcggcgggcagccagagcccagccttgcctccccgattgaaa
gagatgaaaagccaggaatcggctgcaggttccaaactagtccttcggtgtgaaaccagt
tctgaatactcctctctcagattcaagtggttcaagaatgggaatgaattgaatcgaaaa
aacaaaccacaaaatatcaagatacaaaaaaagccagggaagtcagaacttcgcattaac
aaagcatcactggctgattctggagagtatatgtgcaaagtgatcagcaaattaggaaat
gacagtgcctctgccaatatcaccatcgtggaatcaaacgagatcatcactggtatgcca
gcctcaactgaaggagcatatgtgtcttcagagtctcccattagaatatcagtatccaca
gaaggagcaaatacttcttcatctacatctacatccaccactgggacaagccatcttgta
aaatgtgcggagaaggagaaaactttctgtgtgaatggaggggagtgcttcatggtgaaa
gacctttcaaacccctcgagatacttgtgcaagtgccaacctggattcactggagcaaga
tgtactgagaatgtgcccatgaaagtccaaaaccaagaaaaggcggaggagctgtaccag
aagagagtgctgaccataaccggcatctgcatcgccctccttgtggtcggcatcatgtgt
gtggtggcctactgcaaaaccaagaaacagcggaaaaagctgcatgaccgtcttcggcag
agccttcggtctgaacgaaacaatatgatgaacattgccaatgggcctcaccatcctaac
ccaccccccgagaatgtccagctggtgaatcaatacgtatctaaaaacgtcatctccagt
gagcatattgttgagagagaagcagagacatccttttccaccagtcactatacttccaca
gcccatcactccactactgtcacccagactcctagccacagctggagcaacggacacact
gaaagcatcctttccgaaagccactctgtaatcgtgatgtcatccgtagaaaacagtagg
cacagcagcccaactgggggcccaagaggacgtcttaatggcacaggaggccctcgtgaa
tgtaacagcttcctcaggcatgccagagaaacccctgattcctaccgagactctcctcat
agtgaaaggtatgtgtcagccatgaccaccccggctcgtatgtcacctgtagatttccac
acgccaagctcccccaaatcgcccccttcggaaatgtctccacccgtgtccagcatgacg
gtgtccatgccttccatggcggtcagccccttcatggaagaagagagacctctacttctc
gtgacaccaccaaggctgcgggagaagaagtttgaccatcaccctcagcagttcagctcc
ttccaccacaaccccgcgcatgacagtaacagcctccctgctagccccttgaggatagtg
gaggatgaggagtatgaaacgacccaagagtacgagccagcccaagagcctgttaagaaa
ctcgccaatagccggcgggccaaaagaaccaagcccaatggccacattgctaacagattg
gaagtggacagcaacacaagctcccagagcagtaactcagagagtgaaacagaagatgaa
agagtaggtgaagatacgcctttcctgggcatacagaaccccctggcagccagtcttgag
gcaacacctgccttccgcctggctgacagcaggactaacccagcaggccgcttctcgaca
caggaagaaatccaggccaggctgtctagtgtaattgctaaccaagaccctattgctgta
taa

DBGET integrated database retrieval system