KEGG   Homo sapiens (human): 30844Help
Entry
30844             CDS       T01001                                 

Gene name
EHD4, PAST4
Definition
(RefSeq) EH domain containing 4
  KO
K12477  EH domain-containing protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    30844 (EHD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    30844 (EHD4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    30844 (EHD4)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    30844 (EHD4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   30844 (EHD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5600 EHD_N EF-hand_4 Dynamin_N MMR_HSR1 EF-hand_1 EF-hand_7 AAA_16 AAA_28 GTP_EFTU AIG1 AAA_22 TsaE
Motif
Other DBs
NCBI-GeneID: 30844
NCBI-ProteinID: NP_644670
OMIM: 605892
HGNC: 3245
Ensembl: ENSG00000103966
Vega: OTTHUMG00000130370
Pharos: Q9H223(Tbio)
UniProt: Q9H223 A0A024R9N6 A8K9B9
LinkDB All DBs
Position
15q15.1
AA seq 541 aa AA seqDB search
MFSWMGRQAGGRERAGGADAVQTVTGGLRSLYLRKVLPLEEAYRFHEFHSPALEDADFEN
KPMILLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGETEGSTPGNALVVD
PKKPFRKLSRFGNAFLNRFMCSQLPNQVLKSISVIDSPGILSGEKQRISRGYDFCQVLQW
FAERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALM
WSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDL
IKRARLAKVHAYIISYLKKEMPSVFGKENKKRELISRLPEIYIQLQREYQISAGDFPEVK
AMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPTQLVQGGAFDGT
TEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLP
NSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRKSLPKA
D
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgttcagctggatggggcggcaggcgggcgggcgcgaacgcgctggcggcgcggacgcg
gtgcagacggtgacgggcgggctgcgctcgctctacctgcgcaaggtgctgccgctggag
gaggcgtaccgcttccacgagttccactcgcctgcgctggaggacgccgacttcgagaac
aagcccatgatcctgctggtgggccagtacagcaccggcaagaccaccttcatcagatac
ctactggagcaggatttcccaggcatgaggattggtccggagcccaccacagactccttc
atcgccgtgatgtatggagagactgagggcagcaccccagggaatgctttagtcgtggac
cccaaaaagccgtttagaaagctcagtcgctttggaaacgctttcctgaatcgattcatg
tgctcacagctccccaatcaggtcctgaagagcatcagcgtcatcgacagccccggcatc
ctttctggggagaagcagcgcatcagccgaggctatgacttctgccaggtcctgcagtgg
tttgccgagagggtggacaggatcatcctgctctttgacgctcacaagctggacatctca
gatgaattctcagaggccatcaaggccttccggggccaggacgacaagatccgtgtcgtg
ctgaacaaggccgaccaagtggacacgcagcagctgatgcgggtctacggggccctcatg
tggtccctaggcaaggtcatcaacacgcccgaggtactgcgcgtctacattggctccttc
tgggcgcagcccctgcagaacacggacaaccgccggctcttcgaggctgaggcccaggac
ctctttagagacatccagagcctcccccagaaggcagcggtgcgcaagctcaacgacctc
atcaagcgagcgaggctggccaaggtgcatgcctacatcatcagctacctgaagaaggag
atgccaagtgtatttggaaaggaaaacaagaagagagagcttatcagcaggctaccggaa
atctacattcagctacagcgagaataccagatttctgcaggggacttccctgaggtcaag
gctatgcaggaacagcttgagaactatgacttcaccaaattccactcgctgaagcccaag
ctgatcgaggcagtggacaacatgctgagcaacaagatctcgcccctcatgaacctcatc
agccaggaggagacgagcacgcccacgcagctggtgcagggcggcgccttcgatggcacc
accgagggccccttcaaccagggctacggggagggtgccaaggagggcgccgacgaggag
gagtgggtcgtggccaaagacaagcccgtctacgacgagctcttctacactctgtcgccc
atcaatggcaagatatcaggtgtcaacgccaagaaggagatggtgacctccaagctgccc
aacagcgtcctgggcaagatctggaagctggccgactgcgactgcgacggcatgcttgat
gaggaggagttcgcgctggccaagcacctcatcaagatcaagctcgacggctacgagctg
cccagcagcctgcccccccacctcgtgcccccctcgcacaggaagtccctgcccaaggcc
gactga

DBGET integrated database retrieval system