KEGG   Homo sapiens (human): 30845Help
Entry
30845             CDS       T01001                                 

Gene name
EHD3, PAST3
Definition
(RefSeq) EH domain containing 3
  KO
K12476  EH domain-containing protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    30845 (EHD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    30845 (EHD3)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    30845 (EHD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5600 EF-hand_4 EHD_N Dynamin_N MMR_HSR1 EF-hand_1 GTP_EFTU Gtr1_RagA AIG1 AAA_28 AAA_16 EF-hand_7 EF-hand_8 TsaE
Motif
Other DBs
NCBI-GeneID: 30845
NCBI-ProteinID: NP_055415
OMIM: 605891
HGNC: 3244
Ensembl: ENSG00000013016
Vega: OTTHUMG00000099365
Pharos: Q9NZN3(Tbio)
UniProt: Q9NZN3
LinkDB All DBs
Position
2p23.1
AA seq 535 aa AA seqDB search
MFSWLGTDDRRRKDPEVFQTVSEGLKKLYKSKLLPLEEHYRFHEFHSPALEDADFDNKPM
VLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMQGDMEGIIPGNALVVDPKK
PFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAE
RVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSL
GKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKR
ARLAKVHAYIISSLKKEMPSVFGKDNKKKELVNNLAEIYGRIEREHQISPGDFPNLKRMQ
DQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPIQMVKGGAFEGTLHG
PFGHGYGEGAGEGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSV
LGKIWKLADIDKDGMLDDDEFALANHLIKVKLEGHELPNELPAHLLPPSKRKVAE
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgttcagctggctgggtacggacgaccgccggaggaaggaccccgaggttttccagacg
gtgagtgaggggctcaagaaactctacaagagcaagctgctgcccttggaagagcattac
cgcttccacgagttccactcgcccgccctggaggatgccgacttcgacaacaagcccatg
gttctgctggtgggccagtactccactgggaagaccaccttcatcaggtacctgctggaa
caggacttcccaggcatgaggattgggcctgagcccaccacagactccttcattgcggtg
atgcagggagacatggaggggatcatccctgggaacgccctggtggtggatcccaagaaa
cccttcaggaaactcaacgcctttggcaacgccttcttgaacaggttcgtgtgtgcccag
ctacctaaccctgtgctggagagcatcagcgtcatcgacacaccagggatcctctctggg
gagaagcagaggatcagccgggggtatgactttgcagctgtccttgagtggtttgccgag
cgggttgaccgcatcattctgctcttcgatgcccacaaactggacatctctgatgagttc
tcagaagtcatcaaagccctcaagaaccacgaggacaagatgcgagtggtgctgaacaaa
gctgaccagatcgagacgcagcagctgatgcgggtgtacggggccctcatgtggtccttg
gggaagatcgtgaacaccccagaggtgatccgggtctacatcggctccttctggtcccac
cccctcctcatccctgacaaccggaagctctttgaggctgaggaacaggacctattcagg
gacatccagagtctgccccgaaatgctgccctgcgcaagctcaacgacctcatcaaaagg
gccaggctggccaaggtccacgcctacatcatcagctctctgaagaaggagatgccctcg
gtgttcgggaaggacaacaagaagaaggagctggtcaacaacctggccgagatctatggc
cggatcgagcgggagcaccagatctcacctggggacttccccaatctgaagaggatgcag
gaccagctgcaggcccaggactttagcaagttccagccgctgaagagcaagctgctggag
gtagtggacgacatgctggcccatgacattgcccagctcatggtgctagtgcgccaggag
gagtcacagcggcccatccagatggtgaagggcggagcgttcgagggcaccctgcacggc
ccctttgggcatggctatggggagggggctggagaaggtatcgatgatgctgagtgggtg
gtggccagggacaagcccatgtacgacgagatcttctacaccctgtcaccggtggatggc
aagatcacaggcgctaatgccaagaaggagatggtgcgctccaagctgcccaacagtgtg
ctgggcaagatctggaagctggccgacattgacaaggatggcatgctggacgacgacgag
tttgcactggccaaccacctcatcaaagtcaagctggaggggcacgagctgcccaacgag
ctgcctgcccacctcctgcccccgtccaagaggaaagttgccgagtga

DBGET integrated database retrieval system